TkA01G308060 | RubberDandelionOmics

Gene overview

TkA01G308060

Reference: TK1151 Chr: Chr01 Coordinates: 76524551-76526777 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1005 bp · TkA01G308060|TK1151|cDNA

CGATTTCACAACAACTCGTCTATTTTTCTAAGCTTTAAATCACGATAATGATATCATCGGCAACCAATCCCAAATCTCCATCGCCCTAAAACCCATTTTTCCTTTATTTTCGCCGGCGACGAGGTCTTCCCTTCAAAGATCCAGCTTTCACCAACTATACAATGGGTCCACAGCTATTTATAATCAATCACACCACATGCTCGTTGAATTCGTAAACTGAGAAGACATGGTGGGTAATGATACTCCGCCGCTTCCATTCG...

CDS

Download CDS FASTA

450 bp · TkA01G308060|TK1151|CDS

ATGGTGGGTAATGATACTCCGCCGCTTCCATTCGTGACACGTCCGTCTTGCTATTCATCTTCAGCGTCTTCGGAGATCGTCGTTGACGAATCTCCAGTCCCTAACTCTTCCACCTCCGACGACCAACATTTCTCAACGAAGCTCCTGAGCCTCGACGTTTTCGAGCAAGAACAGTGCGTAATTTCGCTGCGAAAAGTCACCAGGGCCGATGAAGAAGTTAGGGTTTCACTCTGCACGCCCCGGCTGCTCTCAGCACTCCG...

Protein

Download Protein FASTA

149 aa · TkA01G308060|TK1151|PROTEIN

MVGNDTPPLPFVTRPSCYSSSASSEIVVDESPVPNSSTSDDQHFSTKLLSLDVFEQEQCVISLRKVTRADEEVRVSLCTPRLLSALRQCLQSRYATIQTNAADALFSLALEEDNKTAIGVLGALQPLLHALHSDSERTRNDSALLIIDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G308060`
TK1151 ID	TkA01G308060
OH-1004 ID	LXL04_009590
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.900
Protein coverage (%)	TK1151 85.235 / OH-1004 23.738 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G308060

Location Chr01:76524551-76526777 (+)

Description Similar to PUB38: U-box domain-containing protein 38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65200`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g40140`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g62560`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009590 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0048364 root development Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:1904821 chloroplast disassembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0070696 transmembrane receptor protein serine/threonine kinase binding Molecular Function

KEGG gene cross-reference

ath:AT2G23140

ath:AT3G47820

ath:AT5G40140

ath:AT5G62560

ath:AT5G65200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · TkA01G308060 · TK1151

Nucleus0.396

Rank 2 · TkA01G308060 · TK1151

Mitochondrion0.082

Rank 3 · TkA01G308060 · TK1151

Cell membrane0.081

Rank 4 · TkA01G308060 · TK1151

Golgi apparatus0.062

Rank 5 · TkA01G308060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10922T7-like_gp1238-80 aa

PF02985HEAT70-76 aa

PF13646HEAT_278-141 aa

PF25780TPR_IPO581-143 aa

PF00514Arm82-109 aa

PF02985HEAT82-108 aa

PF00514Arm113-143 aa

PF02985HEAT124-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G308060	`PF10922`	T7-like_gp12	38	80	0.02	15.8
TkA01G308060	`PF02985`	HEAT	70	76	0.74	11.0
TkA01G308060	`PF13646`	HEAT_2	78	141	0.07	14.1
TkA01G308060	`PF25780`	TPR_IPO5	81	143	0.098	13.7
TkA01G308060	`PF00514`	Arm	82	109	4.1e-09	36.9
TkA01G308060	`PF02985`	HEAT	82	108	0.74	11.0
TkA01G308060	`PF00514`	Arm	113	143	4.1e-09	36.9
TkA01G308060	`PF02985`	HEAT	124	139	0.74	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJP6`	Arabidopsis thaliana	sp\|Q9FJP6\|PUB38_ARATH U-box domain-containing protein 38	42.900%	Swiss-Prot	Medium
`Q9FL17`	Arabidopsis thaliana	sp\|Q9FL17\|PUB40_ARATH U-box domain-containing protein 40	46.200%	Swiss-Prot	Medium
`Q0WUF6`	Arabidopsis thaliana	sp\|Q0WUF6\|PUB41_ARATH U-box domain-containing protein 41	42.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card