Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1086 bp · TkA01G287630|TK1151|cDNA
ATGGGTGTGATTGAGCAATGGAAGAACCGGTGGTCTTTAGTGTTGGAGAAAGCCATTGATTTATGGCAAAGGAGAAGGAAAGAAGTGAAATCGCCTGAGGAGGCGCATACATCAGTAGTTCCAATCGACTACCGAAAGGGTGATAGTGCCATGAATGCGAGCGATGGGATGCAGAAAGGTAGGTTGCGTATAGGACACCCGAGTCAAAAGCAAAACGAAAATCAAAATCCAAGTCAAAATCCTGTGGGTTTCCAGAGCTA...
1086 bp · TkA01G287630|TK1151|CDS
ATGGGTGTGATTGAGCAATGGAAGAACCGGTGGTCTTTAGTGTTGGAGAAAGCCATTGATTTATGGCAAAGGAGAAGGAAAGAAGTGAAATCGCCTGAGGAGGCGCATACATCAGTAGTTCCAATCGACTACCGAAAGGGTGATAGTGCCATGAATGCGAGCGATGGGATGCAGAAAGGTAGGTTGCGTATAGGACACCCGAGTCAAAAGCAAAACGAAAATCAAAATCCAAGTCAAAATCCTGTGGGTTTCCAGAGCTA...
Protein
Download Protein FASTA361 aa · TkA01G287630|TK1151|PROTEIN
MGVIEQWKNRWSLVLEKAIDLWQRRRKEVKSPEEAHTSVVPIDYRKGDSAMNASDGMQKGRLRIGHPSQKQNENQNPSQNPVGFQSYVVIHNIAKRHNVGTLARSATAFGVSELILVGRRDFNAFGSHGSTSHLRFRHFYSLSDARLFLKEKDCDICGVEITDNATAVNGHPFTKNTAFLLGNEGSGLSAKECEFCDYFVYIPQYGCGTASLNVTVAASIVLHHFAVWAGFSERSRDGNKFVVAERPVRKVGRNFSSETA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G287630 |
|---|---|
| TK1151 ID | TkA01G287630 |
| OH-1004 ID | LXL04_003755 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 90.600 |
| Protein coverage (%) | TK1151 96.676 / OH-1004 95.887Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G287630 |
|---|---|
| Location | Chr01:71766033-71772821 (-) |
| Description | Similar to SH2477: Putative TrmH family tRNA/rRNA methyltransferase (Staphylococcus haemolyticus (strain JCSC1435) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002938 tRNA guanine ribose methylation Biological Process GO:0006396 RNA processing Biological Process GO:0030488 tRNA methylation Biological Process GO:0032259 methylation Biological Process GO:0005829 cytosol Cellular Component GO:0000049 tRNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0008173 RNA methyltransferase activity Molecular Function GO:0141100 tRNA (guanine(18)-2'-O)-methyltransferase activity Molecular Function |
| KEGG gene cross-reference | ece:Z5077 ecj:JW3626 eco:b3651 ecoc:C3026_19780 ecs:ECs_4526 sfl:SF3691 sfx:S4078 sha:SH2477 syn:slr0955 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00588SpoU_methylase87-223 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G287630 | PF00588 | SpoU_methylase | 87 | 223 | 7.1e-29 | 101.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.