TkA01G280550 | RubberDandelionOmics

Gene overview

TkA01G280550

Reference: TK1151 Chr: Chr01 Coordinates: 70106705-70108467 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

669 bp · TkA01G280550|TK1151|cDNA

ATGTCTGCATCCTCAAAATTCAGGTTTGTTTTAGTGGGTTTTGATTTCAAGTATTTGGTTATGCATCAGGAGAAGGTGTTGTCCATGAGAAATCACCAGAGATCAATGTTGGATTCGATTACACGAAGAATTAGTTTTTTGGTTGGAGGTGATTTTGACAGGCCCGCTAAACAATTTCAGGTTCTGGAGCTTCTACCAGCTGTCAAGGGTGTTTGTGTTCAAAGCATAGAGCATCCAGGGTGTGTTTGGGATGTGAAATT...

CDS

Download CDS FASTA

669 bp · TkA01G280550|TK1151|CDS

ATGTCTGCATCCTCAAAATTCAGGTTTGTTTTAGTGGGTTTTGATTTCAAGTATTTGGTTATGCATCAGGAGAAGGTGTTGTCCATGAGAAATCACCAGAGATCAATGTTGGATTCGATTACACGAAGAATTAGTTTTTTGGTTGGAGGTGATTTTGACAGGCCCGCTAAACAATTTCAGGTTCTGGAGCTTCTACCAGCTGTCAAGGGTGTTTGTGTTCAAAGCATAGAGCATCCAGGGTGTGTTTGGGATGTGAAATT...

Protein

Download Protein FASTA

222 aa · TkA01G280550|TK1151|PROTEIN

MSASSKFRFVLVGFDFKYLVMHQEKVLSMRNHQRSMLDSITRRISFLVGGDFDRPAKQFQVLELLPAVKGVCVQSIEHPGCVWDVKFMENGDIVTACSDGVARFWTVNQDRLAENHELEAYASLLSHYKGSRKRVGGLKLEELPGLEALQNPGIVFGYGVTSCGKTNTMHMQELPNDIITSNYFFVDTRANLSLWFIFNQSYLSLMFEVKLILFIFWFWRSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G280550`
TK1151 ID	TkA01G280550
OH-1004 ID	LXL04_023497
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 48.899 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G280550`
Location	Chr01:70106705-70108467 (-)
Description	Similar to PLAA: Phospholipase A-2-activating protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023497` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006644 phospholipid metabolic process Biological Process GO:0007165 signal transduction Biological Process GO:0010992 ubiquitin recycling Biological Process GO:0016236 macroautophagy Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process GO:0043335 protein unfolding Biological Process GO:0071222 cellular response to lipopolysaccharide Biological Process GO:1900045 negative regulation of protein K63-linked ubiquitination Biological Process GO:0000153 cytoplasmic ubiquitin ligase complex Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	hsa:9373 mmu:18786 rno:116645 spo:2541208 xla:443698 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.389

Rank 1 · TkA01G280550 · TK1151

Nucleus0.378

Rank 2 · TkA01G280550 · TK1151

Mitochondrion0.124

Rank 3 · TkA01G280550 · TK1151

Endoplasmic reticulum0.112

Rank 4 · TkA01G280550 · TK1151

Cell membrane0.098

Rank 5 · TkA01G280550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25173Beta-prop_WDR3_1st16-33 aa

PF23409Beta-prop_EML20-35 aa

PF00400WD4022-35 aa

PF25175Beta-prop_WDR544-111 aa

PF23381Beta-prop_IFT122_1st69-127 aa

PF00400WD4070-105 aa

PF23409Beta-prop_EML74-114 aa

PF25173Beta-prop_WDR3_1st77-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G280550	`PF25173`	Beta-prop_WDR3_1st	16	33	0.062	13.7
TkA01G280550	`PF23409`	Beta-prop_EML	20	35	0.12	12.6
TkA01G280550	`PF00400`	WD40	22	35	3.2e-05	25.0
TkA01G280550	`PF25175`	Beta-prop_WDR5	44	111	0.033	14.2
TkA01G280550	`PF23381`	Beta-prop_IFT122_1st	69	127	0.0087	16.2
TkA01G280550	`PF00400`	WD40	70	105	3.2e-05	25.0
TkA01G280550	`PF23409`	Beta-prop_EML	74	114	0.12	12.6
TkA01G280550	`PF25173`	Beta-prop_WDR3_1st	77	111	0.062	13.7
TkA01G280550	`PF00225`	Kinesin	154	172	0.08	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card