Gene Card
Gene overview
cDNA / CDS / Protein Sequences
426 bp · TkA01G279870|TK1151|cDNA
ATGTCGGCACAGGATTCTGTTAGCACCGTCTACAAGTGTATGCTGAGAGGTGCTGCAGATTTTCTAGTAAAACCAGTTAGAAAGAACGAATTGAAGGTCTACATACGGATCCTCAGATCCCGATCCTCCGCCTCTTCTCTCAGCTTCCGGGCCATCGATTTCGAGAGTTCTTCACGACAGAAGACTGGAGCGGCCGATTTTGAACAAGGGATAGCAACTTTAGAGGATCTTGATATAGAGCAGGGTTCACATCTTCAATC...
426 bp · TkA01G279870|TK1151|CDS
ATGTCGGCACAGGATTCTGTTAGCACCGTCTACAAGTGTATGCTGAGAGGTGCTGCAGATTTTCTAGTAAAACCAGTTAGAAAGAACGAATTGAAGGTCTACATACGGATCCTCAGATCCCGATCCTCCGCCTCTTCTCTCAGCTTCCGGGCCATCGATTTCGAGAGTTCTTCACGACAGAAGACTGGAGCGGCCGATTTTGAACAAGGGATAGCAACTTTAGAGGATCTTGATATAGAGCAGGGTTCACATCTTCAATC...
Protein
Download Protein FASTA141 aa · TkA01G279870|TK1151|PROTEIN
MSAQDSVSTVYKCMLRGAADFLVKPVRKNELKVYIRILRSRSSASSLSFRAIDFESSSRQKTGAADFEQGIATLEDLDIEQGSHLQSALHNHLKTHGRRMSTPARKRLMRDFKRLQQDPPAGIIGAPVDNNIMLWNAVIFG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G279870 |
|---|---|
| TK1151 ID | TkA01G279870 |
| OH-1004 ID | LXL04_019926 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 52.030Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G279870 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:69976221-69977101 (-) | |||||||||
| Description | Similar to APRR5: Two-component response regulator-like APRR5 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000160 phosphorelay signal transduction system Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007623 circadian rhythm Biological Process GO:0009640 photomorphogenesis Biological Process GO:0009736 cytokinin-activated signaling pathway Biological Process GO:0010017 red or far-red light signaling pathway Biological Process GO:0010114 response to red light Biological Process GO:0010218 response to far red light Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0048511 rhythmic process Biological Process GO:0051170 import into nucleus Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G46790 ath:AT5G24470 dosa:Os03g0284100 dosa:Os09g0532400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00072Response_reg1-35 aaPF00179UQ_con107-141 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G279870 | PF00072 | Response_reg | 1 | 35 | 0.0078 | 17.1 |
| TkA01G279870 | PF00179 | UQ_con | 107 | 141 | 0.016 | 15.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.