TkA01G255010 | RubberDandelionOmics

Gene overview

TkA01G255010

Reference: TK1151 Chr: Chr01 Coordinates: 64315671-64317942 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · TkA01G255010|TK1151|cDNA

CCTAATTCCTATCATCATTATCTCAACTATAAATATCGTTTCTTCCCACCCACTTCTTATAGTTGATCATCTAGATTCTAGCTTTTGTGTGAAAAAACAAAACTAAGCATGAGTTTAATACCATGCAACTATTTCACTCTTGGTGTTTTTATTGGGATTTTTCTTATGCCGTCATCTTGCTTTAGTCAAGAATATTATGTCTCCTCTAGAGCAACATATTATGGTAGTCCTGATTGCCTAGGGACTCCAACTGGTGCTTG...

CDS

Download CDS FASTA

771 bp · TkA01G255010|TK1151|CDS

ATGAGTTTAATACCATGCAACTATTTCACTCTTGGTGTTTTTATTGGGATTTTTCTTATGCCGTCATCTTGCTTTAGTCAAGAATATTATGTCTCCTCTAGAGCAACATATTATGGTAGTCCTGATTGCCTAGGGACTCCAACTGGTGCTTGTGGGTATAAAGTGTATGGAAGCACCATTAATAGTGGTGACGTGAGTGGTGTTTCTAGGCTCTTCAAGAATGGTACTGGTTGTGGAGCATGCTATCAGGTTCGGTGCAA...

Protein

Download Protein FASTA

256 aa · TkA01G255010|TK1151|PROTEIN

MSLIPCNYFTLGVFIGIFLMPSSCFSQEYYVSSRATYYGSPDCLGTPTGACGYKVYGSTINSGDVSGVSRLFKNGTGCGACYQVRCKSPKHCSAEGVKVVVTDHGEGDNTDFILSIHAYNKLALPGLAEELFSYGVVDVEYKRISCQYSGYNLMLKVHEHSKFPEYLSLIAIYQAGVSEITAVEIWQEDCQQWMCMRRAYGAVWDMPNPPRGKPEGAINVRIQVTDSSGSKWVQLKNLIPSEWKVGAAYDTAIQLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G255010`
TK1151 ID	TkA01G255010
OH-1004 ID	LXL04_003855
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 80.251 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G255010

Location Chr01:64315671-64317942 (-)

Description Similar to EXLB1: Expansin-like B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17030`	Expansin-like B1.	No verified direct reference in this release
`At3g45960`	Expansin-like A3.	No verified direct reference in this release
`At4g38400`	Expansin-like A2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0496250`	Expansin-like B1.	No verified direct reference in this release
`Os03g0132200`	Expansin-like A1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003855 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G45960

ath:AT4G17030

dosa:Os03g0132200

dosa:Os10g0542400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.321

Rank 1 · TkA01G255010 · TK1151

Extracellular0.268

Rank 2 · TkA01G255010 · TK1151

Cytoplasm0.158

Rank 3 · TkA01G255010 · TK1151

Endoplasmic reticulum0.122

Rank 4 · TkA01G255010 · TK1151

Cell membrane0.101

Rank 5 · TkA01G255010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22514EXPB1_D135-90 aa

PF29515Expansin_N46-123 aa

PF03330DPBB_166-141 aa

PF01357Expansin_C155-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G255010	`PF22514`	EXPB1_D1	35	90	0.0096	17.0
TkA01G255010	`PF29515`	Expansin_N	46	123	0.00013	22.8
TkA01G255010	`PF03330`	DPBB_1	66	141	7.1e-14	52.5
TkA01G255010	`PF01357`	Expansin_C	155	240	3.6e-17	63.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23547`	Arabidopsis thaliana	sp\|O23547\|EXLB1_ARATH Expansin-like B1	57.100%	Swiss-Prot	High
`Q9LZT5`	Arabidopsis thaliana	sp\|Q9LZT5\|EXLA3_ARATH Expansin-like A3	36.100%	Swiss-Prot	Medium
`Q9SVE5`	Arabidopsis thaliana	sp\|Q9SVE5\|EXLA2_ARATH Expansin-like A2	36.600%	Swiss-Prot	Medium
`Q850K7`	Oryza sativa subsp. japonica	sp\|Q850K7\|EXLB1_ORYSJ Expansin-like B1	39.400%	Swiss-Prot	Medium
`Q10S70`	Oryza sativa subsp. japonica	sp\|Q10S70\|EXLA1_ORYSJ Expansin-like A1	39.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card