Gene Card
Gene overview
cDNA / CDS / Protein Sequences
354 bp · TkA01G252000|TK1151|cDNA
ATGAAACTAACCTTTGATCGCCGGAGGATGTACCGCACAGACAAAGAACATGCCGGAAAGCAGGTTGCTGTTCGTCGGAACAAGACGCTCGGACAGGAGGAAGAGGTCGACGGTGGAAGACGACACAGGAGGGATAGGCGGGAGAGGACAGAGGAAGAGAGTATGCGAGCTGTGAGGCGTAGCAGGAGGAAGAAGACGGACGCCGGAGGGAGAAGACGGTCGCCGGAGGTTTTCGCCGGTAATCGCCACAGAGAGAGCAA...
354 bp · TkA01G252000|TK1151|CDS
ATGAAACTAACCTTTGATCGCCGGAGGATGTACCGCACAGACAAAGAACATGCCGGAAAGCAGGTTGCTGTTCGTCGGAACAAGACGCTCGGACAGGAGGAAGAGGTCGACGGTGGAAGACGACACAGGAGGGATAGGCGGGAGAGGACAGAGGAAGAGAGTATGCGAGCTGTGAGGCGTAGCAGGAGGAAGAAGACGGACGCCGGAGGGAGAAGACGGTCGCCGGAGGTTTTCGCCGGTAATCGCCACAGAGAGAGCAA...
Protein
Download Protein FASTA117 aa · TkA01G252000|TK1151|PROTEIN
MKLTFDRRRMYRTDKEHAGKQVAVRRNKTLGQEEEVDGGRRHRRDRRERTEEESMRAVRRSRRKKTDAGGRRRSPEVFAGNRHRESKSEVAAAKGKSGSVEEGRARMTYLMSSQELG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G252000 |
|---|---|
| TK1151 ID | TkA01G252000 |
| OH-1004 ID | LXL04_013357 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 72.500 |
| Protein coverage (%) | TK1151 87.179 / OH-1004 51.515Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G252000 |
|---|---|
| Location | Chr01:63531153-63532102 (+) |
| Description | Similar to PRE6: Transcription factor PRE6 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009416 response to light stimulus Biological Process GO:0009640 photomorphogenesis Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0040008 regulation of growth Biological Process GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process GO:0080113 regulation of seed growth Biological Process GO:0000325 plant-type vacuole Cellular Component |
| KEGG gene cross-reference | ath:AT1G26945 ath:AT3G28857 ath:AT5G15160 ath:AT5G39860 dosa:Os03g0171300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.