TkA01G225120 | RubberDandelionOmics

Gene overview

TkA01G225120

Reference: TK1151 Chr: Chr01 Coordinates: 57248313-57248978 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA01G225120|TK1151|cDNA

ATGACGATGATGGGTTGTTGCGTTCCCTCTCGTGACACATCGGATCGTTTCTCCGACCGATGCTTCAATGTCTTCCCCTGTCTATCCGATCCCGTTAGAAGATCTACGTTGTGTATGAAATTGGCTTTGGTGATGCTGCATATAGTATTCGTGGGGTTTCTTTTCATATTTGATGACGAATTAATACAGAAATCAAAACAACAACCTTGGTACACCTCCATGTATATGTTGCTGGTTGTTGTTACATTAGTTCAGTATTT...

CDS

Download CDS FASTA

357 bp · TkA01G225120|TK1151|CDS

ATGACGATGATGGGTTGTTGCGTTCCCTCTCGTGACACATCGGATCGTTTCTCCGACCGATGCTTCAATGTCTTCCCCTGTCTATCCGATCCCGTTAGAAGATCTACGTTGTGTATGAAATTGGCTTTGGTGATGCTGCATATAGTATTCGTGGGGTTTCTTTTCATATTTGATGACGAATTAATACAGAAATCAAAACAACAACCTTGGTACACCTCCATGTATATGTTGCTGGTTGTTGTTACATTAGTTCAGTATTT...

Protein

Download Protein FASTA

118 aa · TkA01G225120|TK1151|PROTEIN

MTMMGCCVPSRDTSDRFSDRCFNVFPCLSDPVRRSTLCMKLALVMLHIVFVGFLFIFDDELIQKSKQQPWYTSMYMLLVVVTLVQYFFTSGSSPGYVMIMCLTQYIIFRFFLLYYPSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G225120`
TK1151 ID	TkA01G225120
OH-1004 ID	LXL04_034077
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G225120

Location Chr01:57248313-57248978 (-)

Description Similar to PAT10: Protein S-acyltransferase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51390`	S-acyltransferase involved in protein lipid modification.	Protein S-ACYL Transferase10 is critical for development and salt tolerance in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108829

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034077 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0009651 response to salt stress Biological Process

GO:0099402 plant organ development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0019706 protein-cysteine S-palmitoyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G51390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.388

Rank 1 · TkA01G225120 · TK1151

Golgi apparatus0.274

Rank 2 · TkA01G225120 · TK1151

Cytoplasm0.180

Rank 3 · TkA01G225120 · TK1151

Nucleus0.144

Rank 4 · TkA01G225120 · TK1151

Cell membrane0.132

Rank 5 · TkA01G225120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09843DUF207035-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G225120	`PF09843`	DUF2070	35	115	1.4	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XA86`	Arabidopsis thaliana	sp\|Q7XA86\|ZDH11_ARATH Protein S-acyltransferase 10	61.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card