TkA01G221010 | RubberDandelionOmics

Gene overview

TkA01G221010

Reference: TK1151 Chr: Chr01 Coordinates: 56241386-56246180 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3960 bp · TkA01G221010|TK1151|cDNA

TTTGAATCAGAGGACTCTTCATAATTTCAACTGGCAACAAACGTGGCTGTGTGTTGTTTCGCTTGCTTAGTAATCTTTCATTACCCCAAATCAATTAATATTTAATCCCTTTATTAACAAAAACACTTTTGATACATTGCATTTGATTTCATTTCTTTCCGCGTTCAAAAGTGCTTCTTCTTTTACCAAGAAAAAAGCTTCATGGATCTCTCTCTTTTCCTTCTCAAATGGGCTTTTTAGATTGGAAGATCCCACCATTC...

CDS

Download CDS FASTA

543 bp · TkA01G221010|TK1151|CDS

ATGACCTGCAACTTCTCCTACAACAATCTCAAAGGCCCATTACCTTCCATCCCATTGTTTCACAACATGGCTCTCAGTAGTTTCACCGGAAACAATGGCCTCTGTGGCGGCCCTTTACCAAGTTGTGGTTCCGCCACCGGCTCCGCCCCATCTCCGCCTTCTTTCCGTAGCATCGAGACTCCCAGGGGAAAAACCGTCACAATAACCGCTACAATTATCGGCGGGGTTTCTCTCATTATAATCATCGTCATCTTATATTT...

Protein

Download Protein FASTA

180 aa · TkA01G221010|TK1151|PROTEIN

MTCNFSYNNLKGPLPSIPLFHNMALSSFTGNNGLCGGPLPSCGSATGSAPSPPSFRSIETPRGKTVTITATIIGGVSLIIIIVILYFMKKNVTQNITSVENDTEGSSPLSSDIYFPPKDGFKFQDLVEATRNFHDSYVIGRGAVGTVYKAVMPSGRTIAVKSLRQIEKVGTWKTVSKRKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G221010`
TK1151 ID	TkA01G221010
OH-1004 ID	LXL04_003982
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 90.556 / OH-1004 14.791 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G221010

Location Chr01:56241386-56246180 (+)

Description Similar to At2g33170: Probable leucine-rich repeat receptor-like protein kinase At2g33170

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At2g33170`	Probable leucine-rich repeat receptor-like protein kinase At2g33170.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At2g18470`	Required during abscisic acid (ABA)-mediated activation of Ca(2+) channels.	Plasma membrane-associated proline-rich extensin-like receptor kinase 4, a novel regulator of Ca signalling, is required for abscisic acid responses in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03956.x Arabidopsis proline-rich extensin-like receptor kinase 4 modulates the early event toward abscisic acid response in root tip growth.2009 · DOI: 10.4161/psb.4.11.9739

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003982 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048226 Casparian strip Cellular Component

KEGG gene cross-reference

ath:AT1G17230

ath:AT2G33170

ath:AT4G20140

ath:AT5G63930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.863

Rank 1 · TkA01G221010 · TK1151

Endoplasmic reticulum0.088

Rank 2 · TkA01G221010 · TK1151

Cytoplasm0.063

Rank 3 · TkA01G221010 · TK1151

Nucleus0.043

Rank 4 · TkA01G221010 · TK1151

Lysosome / Vacuole0.025

Rank 5 · TkA01G221010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12175WSS_VP64-125 aa

PF27867Membra_charge68-101 aa

PF00069Pkinase134-167 aa

PF03109ABC1137-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G221010	`PF12175`	WSS_VP	64	125	0.0078	16.4
TkA01G221010	`PF27867`	Membra_charge	68	101	0.11	13.3
TkA01G221010	`PF00069`	Pkinase	134	167	0.02	15.0
TkA01G221010	`PF03109`	ABC1	137	164	0.15	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVP0`	Arabidopsis thaliana	sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930	52.500%	Swiss-Prot	High
`O49318`	Arabidopsis thaliana	sp\|O49318\|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170	47.600%	Swiss-Prot	Medium
`Q9SHI2`	Arabidopsis thaliana	sp\|Q9SHI2\|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	36.200%	Swiss-Prot	Medium
`C0LGQ5`	Arabidopsis thaliana	sp\|C0LGQ5\|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1	30.200%	Swiss-Prot	Medium
`Q9ZNQ8`	Arabidopsis thaliana	sp\|Q9ZNQ8\|PERK4_ARATH Proline-rich receptor-like protein kinase PERK4	39.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card