Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3135 bp · TkA01G215410|TK1151|cDNA
AGGGTTGTATATTTGAAACGCGCTCTCTCTTTCTCTCACTACAATACTCCTTCCGTGTTCTTATCTGTTCAATTAAAAGTAAAAAAAGAACGGAACTTTGCCCCTTCCCCCAACTTAAAGCTGACCCAAAAATTTACCCTTATCATCGTCGTCCTCTTGTCCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCCAACTTTTATGAATCTGTAAAATTCCTCCTAGAGTTTGCTCATTTTCATTCTTTCCATGAAAGCGAAA...
2007 bp · TkA01G215410|TK1151|CDS
ATGGCAGCCATCGACGTTACGAAATATTCCCATAGTCCGACACACAAAGCCGTAGCAGCAAAAGATTACGGTGCCCTGAGGAAAATCATCGCCGGACTGCCACGCCTCTGCGACCCATCAGAGATCCACAACGAATCAATCTCGTTAACCGAGGAAGCCAAAGCCGACACAATCTCTTCAATAATCGACCGGCGTGATGTCCCCAATCGCGACACCCCACTACACCTAGCAGTCAAACTTGGTGACGTCACCTCCACAGA...
Protein
Download Protein FASTA668 aa · TkA01G215410|TK1151|PROTEIN
MAAIDVTKYSHSPTHKAVAAKDYGALRKIIAGLPRLCDPSEIHNESISLTEEAKADTISSIIDRRDVPNRDTPLHLAVKLGDVTSTEMLMLAGADWSLQNEHGWSALQEAICNREEVIARIIVRHYQPIAWAKWCRRLPRLVATMRRMRDFYMEITFQFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRADQTVLFLGDGSEDNKVPPGSLCMISHKNKEIMNALDGAGAPASDAEVQQEVQAMSQTN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G215410 |
|---|---|
| TK1151 ID | TkA01G215410 |
| OH-1004 ID | LXL04_004003 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G215410 |
|---|---|
| Location | Chr01:54894132-54897515 (-) |
| Description | Similar to Ankrd13b: Ankyrin repeat domain-containing protein 13B |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002091 negative regulation of receptor internalization Biological Process GO:0006612 protein targeting to membrane Biological Process GO:0006621 protein retention in ER lumen Biological Process GO:0048259 regulation of receptor-mediated endocytosis Biological Process GO:0005737 cytoplasm Cellular Component GO:0005769 early endosome Cellular Component GO:0005770 late endosome Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0005102 signaling receptor binding Molecular Function GO:0140036 ubiquitin-modified protein reader activity Molecular Function |
| KEGG gene cross-reference | hsa:124930 mmu:268445 xla:379178 xla:431897 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13857Ank_512-30 aaPF00023Ank12-26 aaPF13857Ank_567-110 aaPF12796Ank_267-123 aaPF00023Ank70-100 aaPF13637Ank_474-111 aaPF00023Ank102-122 aaPF11904ANKRD13_C186-642 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G215410 | PF13857 | Ank_5 | 12 | 30 | 6.2e-06 | 27.2 |
| TkA01G215410 | PF00023 | Ank | 12 | 26 | 3.1e-05 | 24.8 |
| TkA01G215410 | PF13857 | Ank_5 | 67 | 110 | 6.2e-06 | 27.2 |
| TkA01G215410 | PF12796 | Ank_2 | 67 | 123 | 4.9e-05 | 24.5 |
| TkA01G215410 | PF00023 | Ank | 70 | 100 | 3.1e-05 | 24.8 |
| TkA01G215410 | PF13637 | Ank_4 | 74 | 111 | 0.077 | 14.1 |
| TkA01G215410 | PF00023 | Ank | 102 | 122 | 3.1e-05 | 24.8 |
| TkA01G215410 | PF11904 | ANKRD13_C | 186 | 642 | 7.8e-115 | 384.5 |
| TkA01G215410 | PF20912 | RPC3_helical | 329 | 351 | 0.27 | 12.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.