TkA01G215290 | RubberDandelionOmics

Gene overview

TkA01G215290

Reference: TK1151 Chr: Chr01 Coordinates: 54863843-54868792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1775 bp · TkA01G215290|TK1151|cDNA

TCATTTGGCGTCGCTTCCTTTTTCTTTCCTTCTGGTGCCCTTGAGTCACCTTCTACTCTCGCTGTCTTCTTCCCTGTTTCTTGAGAAAACGAAGACGACTCTGTTTCACTCCTTATCCGGCCACTATCGCCTCCGCCGGTTTCTTCACCTCCGACAAGCAGCTCAACAGCCAACAGTAGTCCATATTGTCCCCAGCCTACACGAAAGAAATCTCCAAGCTCCATCTAGCGTCACGTCGTATCAAAAGAATAAAAAGGCGG...

CDS

Download CDS FASTA

1275 bp · TkA01G215290|TK1151|CDS

ATGACAGATCTAGTAGCACCGCTTGATTTAGAGGCACTTGAGAGTCGAATTGCCGAAAGTCAAACTAGTTTTCTCGAAGACGAGAATTTGATTACTGAGCTGCTCAGGGAATGTGTTTTCCAGCTTGCGGCGAAAGTTAATGAAACTGTTGAAGAATACTCGGATGTTAGTTCCTTAGAGGCTGAAGATTTGGATGCATATCTGGAGAATTTGAAAGGGGAGGTTTGCTCTGTGGATGCTGAAAATGCTCAAGTTTCTGG...

Protein

Download Protein FASTA

424 aa · TkA01G215290|TK1151|PROTEIN

MTDLVAPLDLEALESRIAESQTSFLEDENLITELLRECVFQLAAKVNETVEEYSDVSSLEAEDLDAYLENLKGEVCSVDAENAQVSGEIENLLHGFLEDSIHLHTNIQGLKSTIDSQGLETKRSPDSPLQLESIGAHGGCKFKLLELNSQIEKKRGMLNSLEDLDYTLKRCEGVLKIEDTFSGVKVIEYEGKRISLSLTTFIPEIEMAEQNHDLSIEFLDGTLEIKNAEVLLFYFTSFVLFCFRVYFNTSNFYTPFDGFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G215290`
TK1151 ID	TkA01G215290
OH-1004 ID	LXL04_004006
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.200
Protein coverage (%)	TK1151 99.528 / OH-1004 81.953 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G215290`
Location	Chr01:54863843-54868792 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004006` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.856

Rank 1 · TkA01G215290 · TK1151

Cytoplasm0.209

Rank 2 · TkA01G215290 · TK1151

Cell membrane0.033

Rank 3 · TkA01G215290 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA01G215290 · TK1151

Golgi apparatus0.021

Rank 5 · TkA01G215290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06698DUF11927-19 aa

PF05791Bacillus_HBL9-35 aa

PF23568ARM_LIN22-125 aa

PF06698DUF119249-82 aa

PF05791Bacillus_HBL60-118 aa

PF06698DUF1192204-211 aa

PF23568ARM_LIN309-351 aa

PF23568ARM_LIN377-420 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G215290	`PF06698`	DUF1192	7	19	0.35	11.7
TkA01G215290	`PF05791`	Bacillus_HBL	9	35	0.036	14.6
TkA01G215290	`PF23568`	ARM_LIN	22	125	0.33	10.9
TkA01G215290	`PF06698`	DUF1192	49	82	0.35	11.7
TkA01G215290	`PF05791`	Bacillus_HBL	60	118	0.036	14.6
TkA01G215290	`PF06698`	DUF1192	204	211	0.35	11.7
TkA01G215290	`PF23568`	ARM_LIN	309	351	0.33	10.9
TkA01G215290	`PF23568`	ARM_LIN	377	420	0.33	10.9
TkA01G215290	`PF05791`	Bacillus_HBL	392	411	0.036	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card