TkA01G208970 | RubberDandelionOmics

Gene overview

TkA01G208970

Reference: TK1151 Chr: Chr01 Coordinates: 53183977-53184420 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA01G208970|TK1151|cDNA

ATGGATTCTTTTTGCAGAGTATGGACATCAGGGAAGCTGTGGAAGACGCTATGGATGCTCAAGCCTTCAACTAGATTCAAGCTCAGATTTAAAAGTGTTATTTCTTGCATTAACAAGTGGTACATTAGTATAATAGCAGACAATTTCAAGAAGCAAAAAAACATATACAAGATACGTGAAGAGAAGTACCAATTAAAATTCAAAGTTCTTGGAACTCTTGTAACCGGTGCTTCAGAAGAAAACAAGCTCATTAACAACCA...

CDS

Download CDS FASTA

315 bp · TkA01G208970|TK1151|CDS

ATGGATTCTTTTTGCAGAGTATGGACATCAGGGAAGCTGTGGAAGACGCTATGGATGCTCAAGCCTTCAACTAGATTCAAGCTCAGATTTAAAAGTGTTATTTCTTGCATTAACAAGTGGTACATTAGTATAATAGCAGACAATTTCAAGAAGCAAAAAAACATATACAAGATACGTGAAGAGAAGTACCAATTAAAATTCAAAGTTCTTGGAACTCTTGTAACCGGTGCTTCAGAAGAAAACAAGCTCATTAACAACCA...

Protein

Download Protein FASTA

104 aa · TkA01G208970|TK1151|PROTEIN

MDSFCRVWTSGKLWKTLWMLKPSTRFKLRFKSVISCINKWYISIIADNFKKQKNIYKIREEKYQLKFKVLGTLVTGASEENKLINNQLQLIKSEKKKMEDIKKT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G208970`
TK1151 ID	TkA01G208970
OH-1004 ID	LXL04_004053
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 49.038 / OH-1004 35.664 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G208970

Location Chr01:53183977-53184420 (-)

Description Similar to KIN14J: Kinesin-like protein KIN-14J

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63640`	Kinesin-like protein KIN-14J.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004053 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0009845 seed germination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G63640

ath:AT3G44730

ath:AT5G41310

dosa:Os03g0301800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.604

Rank 1 · TkA01G208970 · TK1151

Cytoplasm0.207

Rank 2 · TkA01G208970 · TK1151

Nucleus0.164

Rank 3 · TkA01G208970 · TK1151

Cell membrane0.048

Rank 4 · TkA01G208970 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA01G208970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13695Zn_ribbon_3CxxC6-65 aa

PF19285NmU-R2_C_term23-60 aa

PF18801RapH_N30-55 aa

PF18801RapH_N92-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G208970	`PF13695`	Zn_ribbon_3CxxC	6	65	0.34	12.2
TkA01G208970	`PF19285`	NmU-R2_C_term	23	60	0.16	13.0
TkA01G208970	`PF18801`	RapH_N	30	55	0.12	13.1
TkA01G208970	`PF18801`	RapH_N	92	92	0.12	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H6Z8`	Arabidopsis thaliana	sp\|B3H6Z8\|KN14J_ARATH Kinesin-like protein KIN-14J	42.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card