RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G206560
Reference: TK1151 Chr: Chr01 Coordinates: 52582163-52583518 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1281 bp · TkA01G206560|TK1151|cDNA

ATGGCGTCTCCGCCGGACACCAGCAAAACCACCAAGCTCGAACGATACAATTCCTACATACGCAAAGTTAACAGCTCCAAGCTATTAGCTGCCTCCTCTAAGCTTCTCTTTCGTCTCACTCTTTTAGTGACTCTCGTTCTCATCTTCTTCTTCATCCTTAATTACCCTCCACTCTCCGATACCGCCGCCGCCGCAGCCGCCTCCAACCACCGCGTACTCGCCACCTCCCACCTCCTTTCCTCTGCTTTCTACGGTAGCGG...

CDS

Download CDS FASTA

1281 bp · TkA01G206560|TK1151|CDS

ATGGCGTCTCCGCCGGACACCAGCAAAACCACCAAGCTCGAACGATACAATTCCTACATACGCAAAGTTAACAGCTCCAAGCTATTAGCTGCCTCCTCTAAGCTTCTCTTTCGTCTCACTCTTTTAGTGACTCTCGTTCTCATCTTCTTCTTCATCCTTAATTACCCTCCACTCTCCGATACCGCCGCCGCCGCAGCCGCCTCCAACCACCGCGTACTCGCCACCTCCCACCTCCTTTCCTCTGCTTTCTACGGTAGCGG...

Protein

Download Protein FASTA

426 aa · TkA01G206560|TK1151|PROTEIN

MASPPDTSKTTKLERYNSYIRKVNSSKLLAASSKLLFRLTLLVTLVLIFFFILNYPPLSDTAAAAAASNHRVLATSHLLSSAFYGSGASWEKEVRRSSTPRKPNGFSVLVTGAGGFVGTHSSLALKKRGDGVLGLDNFNSYYDPSLKRARQKVLKQHEIFIVEGDLNDGELLAKLFDIVPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLLEIAKNADPQPSIVWASSSSVYGLNTENPFSESHRTDQPASLYAAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G206560
TK1151 IDTkA01G206560
OH-1004 IDLXL04_004070
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)94.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G206560
LocationChr01:52582163-52583518 (-)
DescriptionSimilar to GAE6: UDP-glucuronate 4-epimerase 6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g23820 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.
Identification and characterization of a UDP-D-glucuronate 4-epimerase in Arabidopsis.2004 · DOI: 10.1016/j.febslet.2004.06.005
At1g02000 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components. No verified direct reference in this release
At4g12250 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components. No verified direct reference in this release
At4g00110 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components. No verified direct reference in this release
At2g45310 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004070 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0033481 galacturonate biosynthetic process Biological Process
GO:0050829 defense response to Gram-negative bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0000138 Golgi trans cisterna Cellular Component
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005797 Golgi medial cisterna Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0016020 membrane Cellular Component
GO:0032580 Golgi cisterna membrane Cellular Component
GO:0016854 racemase and epimerase activity Molecular Function
GO:0050378 UDP-glucuronate 4-epimerase activity Molecular Function
KEGG gene cross-reference
ath:AT1G02000
ath:AT2G45310
ath:AT3G23820
ath:AT4G00110
ath:AT4G12250
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.549
Rank 1 · TkA01G206560 · TK1151
Endoplasmic reticulum0.177
Rank 2 · TkA01G206560 · TK1151
Lysosome / Vacuole0.085
Rank 3 · TkA01G206560 · TK1151
Cytoplasm0.069
Rank 4 · TkA01G206560 · TK1151
Extracellular0.054
Rank 5 · TkA01G206560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370Epimerase66-93 aa
PF01370Epimerase108-284 aa
PF04321RmlD_sub_bind108-270 aa
PF02719Polysacc_synt_2108-228 aa
PF00106adh_short108-232 aa
PF16363GDP_Man_Dehyd109-280 aa
PF010733Beta_HSD109-272 aa
PF07993NAD_binding_4110-120 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G206560PF01370Epimerase66935.5e-38131.5
TkA01G206560PF01370Epimerase1082845.5e-38131.5
TkA01G206560PF04321RmlD_sub_bind1082705.4e-1039.5
TkA01G206560PF02719Polysacc_synt_21082282.8e-0730.8
TkA01G206560PF00106adh_short1082320.112.8
TkA01G206560PF16363GDP_Man_Dehyd1092802.2e-40139.8
TkA01G206560PF010733Beta_HSD1092722.9e-0937.1
TkA01G206560PF07993NAD_binding_41101206.5e-0522.9
TkA01G206560PF07993NAD_binding_41562866.5e-0522.9
TkA01G206560PF02719Polysacc_synt_22522732.8e-0730.8
TkA01G206560PF010733Beta_HSD2873182.9e-0937.1
TkA01G206560PF16363GDP_Man_Dehyd2964032.2e-40139.8
TkA01G206560PF01370Epimerase2963205.5e-38131.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LIS3Arabidopsis thalianasp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 667.300%Swiss-ProtHigh
Q9LPC1Arabidopsis thalianasp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 270.100%Swiss-ProtHigh
Q9STI6Arabidopsis thalianasp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 566.700%Swiss-ProtHigh
O81312Arabidopsis thalianasp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 368.900%Swiss-ProtHigh
O22141Arabidopsis thalianasp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 469.900%Swiss-ProtHigh

JBrowse

View in Genome Browser