TkA01G206050 | RubberDandelionOmics

Gene overview

TkA01G206050

Reference: TK1151 Chr: Chr01 Coordinates: 52462579-52464041 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

879 bp · TkA01G206050|TK1151|cDNA

CGATTTTTGTGGGTGATTCCTCTCTGTTACAGTTGAATAGGGCCTATAATCAATCGCAATTGATTATAACTGAAATCAATTGATTAGGGTTTTATTCATCCTCCGACTCCTTCTGCCGTTTCTTTCTCAAGCCATGGATATCGATGAAAATGTTGAAGATGGTTCAAGAAGAGTACAAGTGCGGTTCATTACGAAGCTTAAACTGCCGTTCAAAGCTCCGACAACCTCCATTGCTCTCCCTTCTAATCTTACAAGGATGG...

CDS

Download CDS FASTA

468 bp · TkA01G206050|TK1151|CDS

ATGATGATTGGGTCAATGTTGTTGATGGATCAAATTAGTTGCTATGATGGATTAGGAAGGAGTTTATATATTCAGGATATGGAAAGACGCAAAAGTTTATACACATGTTTTAGAGGGTCACAATGGTGCAATTACATTGGTTCGTGTTGTAAAACCAAAAGGTATGACATTTTTTTACTGAATTCTTCTGTCCAAAGCCTTGCATCACAACCCAATGGCAATATGGTAATTTGCTCTTTTCTCAGTCATTTAATTTCTAA...

Protein

Download Protein FASTA

155 aa · TkA01G206050|TK1151|PROTEIN

MMIGSMLLMDQISCYDGLGRSLYIQDMERRKSLYTCFRGSQWCNYIGSCCKTKRYDIFLLNSSVQSLASQPNGNMVICSFLSHLISKFILFSYSFLIFLQICSSSWDCRINLWETECNKGDFVSIKKRKKGSKEEESQSDYFRLFQVFYTIFYVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G206050`
TK1151 ID	TkA01G206050
OH-1004 ID	LXL04_025941
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.700
Protein coverage (%)	TK1151 83.871 / OH-1004 46.875 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G206050

Location Chr01:52462579-52464041 (+)

Description Similar to WDR12: Ribosome biogenesis protein WDR12 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15550`	Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0051276 chromosome organization Biological Process

GO:0110136 protein-RNA complex remodeling Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0030687 preribosome, large subunit precursor Cellular Component

GO:0070545 PeBoW complex Cellular Component

GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component

GO:0043021 ribonucleoprotein complex binding Molecular Function

KEGG gene cross-reference

ang:An04g02000

ath:AT5G15550

dosa:Os07g0600400

nfi:NFIA_108560

osa:4343819

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.480

Rank 1 · TkA01G206050 · TK1151

Cytoplasm0.386

Rank 2 · TkA01G206050 · TK1151

Mitochondrion0.121

Rank 3 · TkA01G206050 · TK1151

Endoplasmic reticulum0.071

Rank 4 · TkA01G206050 · TK1151

Cell membrane0.065

Rank 5 · TkA01G206050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00400WD4062-79 aa

PF00400WD40101-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G206050	`PF00400`	WD40	62	79	0.012	16.9
TkA01G206050	`PF00400`	WD40	101	113	0.012	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF27`	Arabidopsis thaliana	sp\|Q9LF27\|WDR12_ARATH Ribosome biogenesis protein WDR12 homolog	37.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card