TkA01G204820 | RubberDandelionOmics

Gene overview

TkA01G204820

Reference: TK1151 Chr: Chr01 Coordinates: 52148698-52151875 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2632 bp · TkA01G204820|TK1151|cDNA

AACAATGAAAACGGACAGAGTATTGCTAGGGTATAAAACTCAGCACCTTTTTGTCTCTGTTCCAGCAGCCACCCTATCATAGTTTCATAGTTTCTTCATCTACCAAGACTTTGTACCAACACCTGCCCTCATTCTTCCCACTCTGTCTCCATTCGCTCTTGATTCTTTCACCCAATCTCTCTTTTCTATAACCATTTTCTCCTCTTTTTGATCGTAGCACAGACATGGATGTCCAAGATCATAACAAACACCCAATCCCA...

CDS

Download CDS FASTA

2226 bp · TkA01G204820|TK1151|CDS

ATGGATGTCCAAGATCATAACAAACACCCAATCCCATCAGGACATGTGAGTCATGGGGTTCATTTATGTCATAGATGTGGCTGGCCTTTCCCGAACCCACATCCAAGTTCTAGACAGAGGCGATCGCACAAGAAGATCTGTGGAACCATCGACGGTTACACTAATTTAATCCATTCAGAAGTGGTTTCAGACGATGAACACCATCCTGATGACGATAAAGACAAAAGTCCAAGTCCCAAAATCGAGAAGAAGACGAGCAT...

Protein

Download Protein FASTA

741 aa · TkA01G204820|TK1151|PROTEIN

MDVQDHNKHPIPSGHVSHGVHLCHRCGWPFPNPHPSSRQRRSHKKICGTIDGYTNLIHSEVVSDDEHHPDDDKDKSPSPKIEKKTSISGGDGAIGRSFSRSEDDSFSDAVTEFADTTSTGSVNKALDRDLFFSFKDAENEISKVDSSEGKSELPDSVKDGVVEPKVEQSDVSHSHEEAAFIDVVGAGVKSETVTADGINEEIKNENLESESKHVSETVKEAEQVHELVSEVAKESEIGQKLEGVGEETKHEKIELDHENV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G204820`
TK1151 ID	TkA01G204820
OH-1004 ID	LXL04_004083
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G204820`
Location	Chr01:52148698-52151875 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004083` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.481

Rank 1 · TkA01G204820 · TK1151

Cytoplasm0.367

Rank 2 · TkA01G204820 · TK1151

Nucleus0.281

Rank 3 · TkA01G204820 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA01G204820 · TK1151

Golgi apparatus0.038

Rank 5 · TkA01G204820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11247Phage_T7_55101-130 aa

PF02915Rubrerythrin218-284 aa

PF11247Phage_T7_55219-293 aa

PF11247Phage_T7_55303-329 aa

PF12452DUF3685337-399 aa

PF02915Rubrerythrin646-703 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G204820	`PF11247`	Phage_T7_55	101	130	1.3	10.2
TkA01G204820	`PF02915`	Rubrerythrin	218	284	9.8	7.3
TkA01G204820	`PF11247`	Phage_T7_55	219	293	1.3	10.2
TkA01G204820	`PF11247`	Phage_T7_55	303	329	1.3	10.2
TkA01G204820	`PF12452`	DUF3685	337	399	0.34	11.3
TkA01G204820	`PF02915`	Rubrerythrin	646	703	9.8	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card