TkA01G199160 | RubberDandelionOmics

Gene overview

TkA01G199160

Reference: TK1151 Chr: Chr01 Coordinates: 50768144-50770095 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1480 bp · TkA01G199160|TK1151|cDNA

AAACGACTATCGGCGGGGGCAAACGGGAATTGCTTTCTATGGCACTGACGTCGTCAATGACATCATACTATTCCCTTTCTTGAAGGCGGCGCTAATCAAACCAAGGTTTCTACTGTATAATTAATCTTTTAACAATCCAAATAGTATTTAAACCACATTAGTATAAGCAAATTCAAATCGACAGAAAACAATGGCGACGGCGATTCCACAAGTGAAATTAGGTTCACAAGGCTTAGTTGTTTCAGCACAGGGATTGGGAT...

CDS

Download CDS FASTA

1023 bp · TkA01G199160|TK1151|CDS

ATGGCGACGGCGATTCCACAAGTGAAATTAGGTTCACAAGGCTTAGTTGTTTCAGCACAGGGATTGGGATGTATGGGTATGTCAGCGCAATACGGGCTTCCAAAACCCGAAGCCGATATGATAAAGCTCATCCACCACGCCATTGACTCCGGCGTCACTTTCCTTGACACCTCCGACGTCTACGGCCCTCACACCAACGAAATCCTCATCGGCAAGGCTTTGAAAGGAGGACTAAGAGAGAAAGTTCAAATTGCTACCAA...

Protein

Download Protein FASTA

340 aa · TkA01G199160|TK1151|PROTEIN

MATAIPQVKLGSQGLVVSAQGLGCMGMSAQYGLPKPEADMIKLIHHAIDSGVTFLDTSDVYGPHTNEILIGKALKGGLREKVQIATKFAIRRVDGKMDVCGDPAYVRSACEASLKRLDIDCIDLYYIHRIDIRVPIEVTMGELKKLVEEGKVKYVGLSEASASTIRRAHAVHPITAVQNEWSIWSRDLESEIIPTCRELGIGIVPYSPIGRGFLASGPKLAENLIEGDFRKSHPRFQNAEQNKTVFELVNEIATRKGCTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G199160`
TK1151 ID	TkA01G199160
OH-1004 ID	LXL04_004128
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 49.492 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G199160

Location Chr01:50768144-50770095 (+)

Description Similar to Os04g0338000: Probable aldo-keto reductase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60710`	Probable aldo-keto reductase 4.	No verified direct reference in this release
`At1g60690`	Probable aldo-keto reductase 3.	No verified direct reference in this release
`At1g60730`	Probable aldo-keto reductase 5.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0338000`	Probable aldo-keto reductase 2.	No verified direct reference in this release
`UniProt: A2XRZ0`	Probable aldo-keto reductase 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004128 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60690

dosa:Os04g0338000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.776

Rank 1 · TkA01G199160 · TK1151

Nucleus0.325

Rank 2 · TkA01G199160 · TK1151

Mitochondrion0.088

Rank 3 · TkA01G199160 · TK1151

Peroxisome0.088

Rank 4 · TkA01G199160 · TK1151

Cell membrane0.050

Rank 5 · TkA01G199160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248Aldo_ket_red21-306 aa

PF24878YkcB_C138-160 aa

PF05922Inhibitor_I9145-155 aa

PF05922Inhibitor_I9279-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G199160	`PF00248`	Aldo_ket_red	21	306	1.3e-73	248.3
TkA01G199160	`PF24878`	YkcB_C	138	160	0.084	13.5
TkA01G199160	`PF05922`	Inhibitor_I9	145	155	0.17	13.3
TkA01G199160	`PF05922`	Inhibitor_I9	279	315	0.17	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZN2`	Arabidopsis thaliana	sp\|Q93ZN2\|ALKR4_ARATH Probable aldo-keto reductase 4	71.500%	Swiss-Prot	High
`O22707`	Arabidopsis thaliana	sp\|O22707\|ALKR3_ARATH Probable aldo-keto reductase 3	69.900%	Swiss-Prot	High
`Q9ASZ9`	Arabidopsis thaliana	sp\|Q9ASZ9\|ALKR5_ARATH Probable aldo-keto reductase 5	70.300%	Swiss-Prot	High
`Q7XT99`	Oryza sativa subsp. japonica	sp\|Q7XT99\|AKR2_ORYSJ Probable aldo-keto reductase 2	71.800%	Swiss-Prot	High
`A2XRZ0`	Oryza sativa subsp. indica	sp\|A2XRZ0\|AKR2_ORYSI Probable aldo-keto reductase 2	71.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card