TkA01G198520 | RubberDandelionOmics

Gene overview

TkA01G198520

Reference: TK1151 Chr: Chr01 Coordinates: 50616001-50617062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · TkA01G198520|TK1151|cDNA

ATGACATACATCCCGCCGGATATCCTTGATCATATACTGATAAGATTAAACGTGGTGGATCTGATTCGATGCAAGGCTGTGTCGAAGTCCTGGAACGCTTTCATCTCCGATTCATGTTTCATTAAAGCTCACATTCACCATAGCTATAACACCGATCTCAAAAATGACGAAATTGGACACCGGAGAATAGTTATGTCAGTATATGCCACTTACTACATTCTACTCGGTTCTTCCAATGGTCTGGTATGCGTCTCCGCTGG...

CDS

Download CDS FASTA

834 bp · TkA01G198520|TK1151|CDS

ATGACATACATCCCGCCGGATATCCTTGATCATATACTGATAAGATTAAACGTGGTGGATCTGATTCGATGCAAGGCTGTGTCGAAGTCCTGGAACGCTTTCATCTCCGATTCATGTTTCATTAAAGCTCACATTCACCATAGCTATAACACCGATCTCAAAAATGACGAAATTGGACACCGGAGAATAGTTATGTCAGTATATGCCACTTACTACATTCTACTCGGTTCTTCCAATGGTCTGGTATGCGTCTCCGCTGG...

Protein

Download Protein FASTA

277 aa · TkA01G198520|TK1151|PROTEIN

MTYIPPDILDHILIRLNVVDLIRCKAVSKSWNAFISDSCFIKAHIHHSYNTDLKNDEIGHRRIVMSVYATYYILLGSSNGLVCVSAGRTEILVINPSTREVKKLTKPQIPETGTLSWGFGYDSSTNDYKVVLGFKSAEKFLEVPQPNDVGYQTRFGHDSWMRLGNMEGCLCVFRYPELSDDLWVMKEYNVMSWEMFDCSRGIKNDALHGINRLLNYVPNKRTFCYEPGLCQSWLLLGAPLYVESLVSPHFHKRLKRKRRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G198520`
TK1151 ID	TkA01G198520
OH-1004 ID	LXL04_004136
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	76.700
Protein coverage (%)	TK1151 98.917 / OH-1004 40.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G198520

Location Chr01:50616001-50617062 (+)

Description Similar to CPR1: F-box protein CPR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12560`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	An F-box gene, CPR30, functions as a negative regulator of the defense response in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03995.x
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004136 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G16210

ath:AT3G23880

ath:AT4G12560

ath:AT4G22390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · TkA01G198520 · TK1151

Nucleus0.435

Rank 2 · TkA01G198520 · TK1151

Cell membrane0.120

Rank 3 · TkA01G198520 · TK1151

Endoplasmic reticulum0.080

Rank 4 · TkA01G198520 · TK1151

Lysosome / Vacuole0.039

Rank 5 · TkA01G198520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like3-38 aa

PF00646F-box4-40 aa

PF08268FBA_359-135 aa

PF07734FBA_178-134 aa

PF08268FBA_3158-194 aa

PF00646F-box244-258 aa

PF00646F-box264-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G198520	`PF12937`	F-box-like	3	38	3.5e-08	33.8
TkA01G198520	`PF00646`	F-box	4	40	3.4e-08	33.8
TkA01G198520	`PF08268`	FBA_3	59	135	7.4e-09	35.8
TkA01G198520	`PF07734`	FBA_1	78	134	1.7e-05	24.7
TkA01G198520	`PF08268`	FBA_3	158	194	7.4e-09	35.8
TkA01G198520	`PF00646`	F-box	244	258	3.4e-08	33.8
TkA01G198520	`PF00646`	F-box	264	271	3.4e-08	33.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU30`	Arabidopsis thaliana	sp\|Q9SU30\|CPR1_ARATH F-box protein CPR1	31.200%	Swiss-Prot	Medium
`Q8GXC7`	Arabidopsis thaliana	sp\|Q8GXC7\|FBK50_ARATH F-box/kelch-repeat protein At3g06240	31.600%	Swiss-Prot	Low
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	26.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card