TkA01G184730 | RubberDandelionOmics

Gene overview

TkA01G184730

Reference: TK1151 Chr: Chr01 Coordinates: 47413995-47415569 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · TkA01G184730|TK1151|cDNA

CTGGGGTGGGTCCCTAATGTCGAGTCCACACGAGACACCTCTGTCTCTCCCTCATCCCCTGTCACTCTCCAAATACTCCACCATTCCCCAAATCCAATTCACAGCAGCTATAAAACACTCCCATGGCGTTCTCAATTCTCCTCATCTTCAGATTCCAGATTCCGTATTCAGTTCGCACATATTTCTGCTTCAACCGGAAAGAAGACCGACCACCAGATAGAGACTCGATTCAAGTCCATCACAATAGAATATGAGATCAC...

CDS

Download CDS FASTA

921 bp · TkA01G184730|TK1151|CDS

ATGAGATCACCGTCGAAAACCGTAACAAAAAGGGTTAGAGATGCTGAATCTGAGTTGAATTTGCCTCCTGGTTTCCGATTTCACCCGACAGACGAGGAACTCGTCGTTCACTATCTCTGCCTCAAGTCCCAACCGACGGCGGAGATGGCTGGTGTCGCTCCACCACCGTCAATCATCGCCGATGTTGATCTCTACAAACACGATCCATGGGAGCTGCCTGAACTGGCTCTGTTTGGAACGAAGGAATGGTACTTTTTCAC...

Protein

Download Protein FASTA

306 aa · TkA01G184730|TK1151|PROTEIN

MRSPSKTVTKRVRDAESELNLPPGFRFHPTDEELVVHYLCLKSQPTAEMAGVAPPPSIIADVDLYKHDPWELPELALFGTKEWYFFTPRDKKYPNGSRPNRVTGNGYWKATGADKPIKRKSDPNAIVGIKKALVFYAGKGAKGIKTNWIMHEYRPNPTHSKTTISKLEDWVLCRLYNKNNNPNEKIIPEDNIHHSRDLHLDESERGNSCSNNSDGMNSFEDSDGEFGDVMFLSELTSDVLTKVKGTSEQSSMEFMENLMH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G184730`
TK1151 ID	TkA01G184730
OH-1004 ID	LXL04_004206
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.771 / OH-1004 89.783 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G184730

Location Chr01:47413995-47415569 (+)

Description Similar to NAC068: NAC domain-containing protein 68

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08790`	Involved in disease resistance response.	The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02488.x Interaction of the Tobacco mosaic virus replicase protein with a NAC domain transcription factor is associated with the suppression of systemic host defenses.2009 · DOI: 10.1128/jvi.00941-09 ATAF2, a NAC transcription factor, binds to the promoter and regulates NIT2 gene expression involved in auxin biosynthesis.2012 · DOI: 10.1007/s10059-012-0122-2 ATAF2 integrates Arabidopsis brassinosteroid inactivation and seedling photomorphogenesis.2015 · DOI: 10.1242/dev.124347

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0816100`	Probable transcription factor involved in stress response.	No verified direct reference in this release
`Os03g0815100`	Transcription factor that possesses transactivation activity.	Overexpressing a NAM, ATAF, and CUC (NAC) transcription factor enhances drought resistance and salt tolerance in rice.2006 · DOI: 10.1073/pnas.0604882103 The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.2010 · DOI: 10.1007/s00438-010-0557-0
`Os07g0225300`	Probable transcription factor involved in stress response.	No verified direct reference in this release
`Os01g0884300`	Transcription activator that binds to the promoter of the stress response gene LEA19.	Functional analysis of a NAC-type transcription factor OsNAC6 involved in abiotic and biotic stress-responsive gene expression in rice.2007 · DOI: 10.1111/j.1365-313x.2007.03168.x Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice.2008 · DOI: 10.1007/s11103-008-9309-5 The histone deacetylase OsHDAC1 epigenetically regulates the OsNAC6 gene that controls seedling root growth in rice.2009 · DOI: 10.1111/j.1365-313x.2009.03908.x The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.2010 · DOI: 10.1007/s00438-010-0557-0 The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance.2017 · DOI: 10.1111/pbi.12673

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

KEGG gene cross-reference

ath:AT4G27410

ath:AT5G08790

dosa:Os01g0816100

dosa:Os03g0815100

dosa:Os07g0225300

osa:4334553

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.937

Rank 1 · TkA01G184730 · TK1151

Cytoplasm0.121

Rank 2 · TkA01G184730 · TK1151

Cell membrane0.050

Rank 3 · TkA01G184730 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA01G184730 · TK1151

Plastid0.016

Rank 5 · TkA01G184730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM22-154 aa

PF06528Phage_P2_GpE68-75 aa

PF02365NAM179-198 aa

PF06528Phage_P2_GpE268-282 aa

PF06528Phage_P2_GpE288-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G184730	`PF02365`	NAM	22	154	2.5e-46	157.9
TkA01G184730	`PF06528`	Phage_P2_GpE	68	75	2.9	8.2
TkA01G184730	`PF02365`	NAM	179	198	2.5e-46	157.9
TkA01G184730	`PF06528`	Phage_P2_GpE	268	282	2.9	8.2
TkA01G184730	`PF06528`	Phage_P2_GpE	288	294	2.9	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C598`	Arabidopsis thaliana	sp\|Q9C598\|NAC81_ARATH Protein ATAF2	61.100%	Swiss-Prot	Medium
`Q52QH4`	Oryza sativa subsp. japonica	sp\|Q52QH4\|NAC68_ORYSJ NAC domain-containing protein 68	67.100%	Swiss-Prot	Medium
`Q75HE5`	Oryza sativa subsp. japonica	sp\|Q75HE5\|NAC2_ORYSJ NAC domain-containing protein 2	65.300%	Swiss-Prot	Medium
`Q7EZT1`	Oryza sativa subsp. japonica	sp\|Q7EZT1\|NAC67_ORYSJ NAC domain-containing protein 67	62.500%	Swiss-Prot	Medium
`Q7F2L3`	Oryza sativa subsp. japonica	sp\|Q7F2L3\|NAC48_ORYSJ NAC domain-containing protein 48	62.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card