TkA01G180370 | RubberDandelionOmics

Gene overview

TkA01G180370

Reference: TK1151 Chr: Chr01 Coordinates: 46238269-46239174 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · TkA01G180370|TK1151|cDNA

ATGTCACAGAACTGCCACCGCCGTCTTAAAATAGTCGCCGGTGCTGACCCTTTTGGTTGCGCCCTCAAGGATACCCTCGTCTCACACCTCCAGTCCCTCGACATCGATGTCGAGGACCTCGGCACCGATAACTACTACTCCGTCGGCGAAAAAATCGGCCGCATCGTCAGCTGCGCTGCCAATTCCCCTGAAACCGAAGTCCGCGGTCTCGTCGCCTGCGGTACTGGCGTCGGTGTATCTATCTTCGCCAACAAGTTACC...

CDS

Download CDS FASTA

906 bp · TkA01G180370|TK1151|CDS

ATGTCACAGAACTGCCACCGCCGTCTTAAAATAGTCGCCGGTGCTGACCCTTTTGGTTGCGCCCTCAAGGATACCCTCGTCTCACACCTCCAGTCCCTCGACATCGATGTCGAGGACCTCGGCACCGATAACTACTACTCCGTCGGCGAAAAAATCGGCCGCATCGTCAGCTGCGCTGCCAATTCCCCTGAAACCGAAGTCCGCGGTCTCGTCGCCTGCGGTACTGGCGTCGGTGTATCTATCTTCGCCAACAAGTTACC...

Protein

Download Protein FASTA

301 aa · TkA01G180370|TK1151|PROTEIN

MSQNCHRRLKIVAGADPFGCALKDTLVSHLQSLDIDVEDLGTDNYYSVGEKIGRIVSCAANSPETEVRGLVACGTGVGVSIFANKLPCVYAATCLTPSDTINARSINNCNVIAFAGTSTSPDSAIETLNNFLNTPFRSPCPASNSEPWPENIQTFLADSLTVMSKIGTHPPPALTSCSICNIAAGRDFSPIEIMPGGSMKIVRDTPTSAIVRFTAGSIEPAHHHTHGHDVVVMKGRKTVWNLTKSERFELGVGDYLYVPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G180370`
TK1151 ID	TkA01G180370
OH-1004 ID	LXL04_004242
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G180370

Location Chr01:46238269-46239174 (-)

Description Similar to DRT102: DNA damage-repair/toleration protein DRT102

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04880`	DNA damage-repair/toleration protein DRT102.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004242 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006098 pentose-phosphate shunt Biological Process

GO:0006281 DNA repair Biological Process

GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process

GO:0019316 D-allose catabolic process Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0019512 lactose catabolic process via tagatose-6-phosphate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004751 ribose-5-phosphate isomerase activity Molecular Function

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ag:EJF39089

ath:AT3G04880

eca:ECA0863

lin:lin0363

smu:SMU_1495

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.780

Rank 1 · TkA01G180370 · TK1151

Nucleus0.513

Rank 2 · TkA01G180370 · TK1151

Mitochondrion0.057

Rank 3 · TkA01G180370 · TK1151

Peroxisome0.045

Rank 4 · TkA01G180370 · TK1151

Cell membrane0.030

Rank 5 · TkA01G180370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02502LacAB_rpiB11-137 aa

PF12973Cupin_7203-275 aa

PF07883Cupin_2210-273 aa

PF14499DUF4437214-283 aa

PF02311AraC_binding220-276 aa

PF16867DMSP_lyase220-270 aa

PF01050MannoseP_isomer221-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G180370	`PF02502`	LacAB_rpiB	11	137	7.3e-25	88.2
TkA01G180370	`PF12973`	Cupin_7	203	275	7.3e-06	26.5
TkA01G180370	`PF07883`	Cupin_2	210	273	6.2e-08	32.9
TkA01G180370	`PF14499`	DUF4437	214	283	0.03	14.2
TkA01G180370	`PF02311`	AraC_binding	220	276	0.19	12.1
TkA01G180370	`PF16867`	DMSP_lyase	220	270	0.24	11.8
TkA01G180370	`PF01050`	MannoseP_isomer	221	267	0.29	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q05212`	Arabidopsis thaliana	sp\|Q05212\|DR102_ARATH DNA damage-repair/toleration protein DRT102	60.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card