TkA01G174910 | RubberDandelionOmics

Gene overview

TkA01G174910

Reference: TK1151 Chr: Chr01 Coordinates: 44821854-44826950 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1578 bp · TkA01G174910|TK1151|cDNA

CTTACCTTCCAAACGATGCATTAACATCAAATTCTAATCACACCCACTCACCGTTTGGGTTGCACCGTTCTCCCGCTTCTCTCTTTCGGATTTCTTCGTCATCCATCCTCTTCACCATGGTCACCCTTGTTCTTCCACCATCACCATCATATTCCTCCATCATACAACGTAAGCAGGTCTCAAAGTTTCAATCTAAGGATTATTATTGATCGTTTCTTTCAGAAACCAACCGCAGTGCGCTTGGCCATGCATATATGCTT...

CDS

Download CDS FASTA

1086 bp · TkA01G174910|TK1151|CDS

ATGGCTCCATCAATGTCAATAATCCAGTCAAACCCGGTCAACATCCTAGATTTCGTGGTCAACAAAGGGCACGGAGTCAAAGGTTTATCAGAACTCGGACTCGAAACACTACCACACCAATACATACAACCTCCACAAGAACGGTTTGATCATACGACCAATGAGGAGCCCAATATACACTGTATCCCGGTTATCGATATGTCCAATTGGGATGACCCGGATGTAGCTAAAGCAGTATGTGATGCCGCATGCAAATGGGG...

Protein

Download Protein FASTA

361 aa · TkA01G174910|TK1151|PROTEIN

MAPSMSIIQSNPVNILDFVVNKGHGVKGLSELGLETLPHQYIQPPQERFDHTTNEEPNIHCIPVIDMSNWDDPDVAKAVCDAACKWGFFQIVNHGVPIRVLEDVKDATHKFYALPAEEKQKYSKERSVSNNVRCGTSFTPEAEKALEWKDYLSLFFVSDDEAASLWPHVCRNEALEYMKCSESVVKKLLEILMKGLNVKEIDETKEAILMGSKRINLNYYPKCPTPELTIGVGRHSDVSTLTVLLQDDIGGLYVRNIETM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G174910`
TK1151 ID	TkA01G174910
OH-1004 ID	LXL04_004282
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 95.756 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G174910

Location Chr01:44821854-44826950 (+)

Description Similar to F6H1-3: Feruloyl CoA ortho-hydroxylase F6H1-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13610`	May act as a 2-oxoglutarate- and Fe²⁺-dependent dioxygenase in scopoletin biosynthesis.	Scopoletin is biosynthesized via ortho-hydroxylation of feruloyl CoA by a 2-oxoglutarate-dependent dioxygenase in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03568.x Mutually exclusive alterations in secondary metabolism are critical for the uptake of insoluble iron compounds by Arabidopsis and Medicago truncatula.2013 · DOI: 10.1104/pp.113.220426 Feruloyl-CoA 6'-Hydroxylase1-dependent coumarins mediate iron acquisition from alkaline substrates in Arabidopsis.2014 · DOI: 10.1104/pp.113.228544

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004282 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009620 response to fungus Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010421 hydrogen peroxide-mediated programmed cell death Biological Process

GO:0010447 response to acidic pH Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT3G13610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.804

Rank 1 · TkA01G174910 · TK1151

Nucleus0.330

Rank 2 · TkA01G174910 · TK1151

Peroxisome0.064

Rank 3 · TkA01G174910 · TK1151

Mitochondrion0.053

Rank 4 · TkA01G174910 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA01G174910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF031712OG-FeII_Oxy16-42 aa

PF14226DIOX_N62-166 aa

PF16877DUF507897-162 aa

PF09613HrpB1_HrpK176-206 aa

PF01994Trm56190-247 aa

PF031712OG-FeII_Oxy216-312 aa

PF16877DUF5078336-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G174910	`PF03171`	2OG-FeII_Oxy	16	42	2.2e-30	105.7
TkA01G174910	`PF14226`	DIOX_N	62	166	5.6e-24	85.8
TkA01G174910	`PF16877`	DUF5078	97	162	0.14	13.4
TkA01G174910	`PF09613`	HrpB1_HrpK	176	206	0.12	12.8
TkA01G174910	`PF01994`	Trm56	190	247	0.11	13.1
TkA01G174910	`PF03171`	2OG-FeII_Oxy	216	312	2.2e-30	105.7
TkA01G174910	`PF16877`	DUF5078	336	347	0.14	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHN8`	Arabidopsis thaliana	sp\|Q9LHN8\|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1	66.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card