TkA01G174750 | RubberDandelionOmics

Gene overview

TkA01G174750

Reference: TK1151 Chr: Chr01 Coordinates: 44763822-44764403 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · TkA01G174750|TK1151|cDNA

ATGGCCGTCGCAGCGGAGTTGATCTCGGGTAAGTGGTTAAAGATTTGGATCGAAATCGGAGCTGTATTATCAGCTATAGGTTTATTCGAGGCTCAGTTAAGCAGTTGTGCTTATCAAGTTCTGGGCATGGCGGATTTAGGTTTTTTACCGAAGTTTTTTGGTGTCCGATCAAAATGGTTCGGAACTCCATGGGTGGGGATTCTGTTATCGACGGTGATTACAATCGCCGTTTCTCCGATGGATTTCACTGATATAGTAGC...

CDS

Download CDS FASTA

582 bp · TkA01G174750|TK1151|CDS

ATGGCCGTCGCAGCGGAGTTGATCTCGGGTAAGTGGTTAAAGATTTGGATCGAAATCGGAGCTGTATTATCAGCTATAGGTTTATTCGAGGCTCAGTTAAGCAGTTGTGCTTATCAAGTTCTGGGCATGGCGGATTTAGGTTTTTTACCGAAGTTTTTTGGTGTCCGATCAAAATGGTTCGGAACTCCATGGGTGGGGATTCTGTTATCGACGGTGATTACAATCGCCGTTTCTCCGATGGATTTCACTGATATAGTAGC...

Protein

Download Protein FASTA

193 aa · TkA01G174750|TK1151|PROTEIN

MAVAAELISGKWLKIWIEIGAVLSAIGLFEAQLSSCAYQVLGMADLGFLPKFFGVRSKWFGTPWVGILLSTVITIAVSPMDFTDIVASANFIYSLGMLLEFASFIWLRRKFPTLKRPYKVPLGVPGLVVMCLVPSAFLVLIMVIATKIVYLVSGLMTVGAIFWYFLMNYCKSKKWFVFANGDEIEGGEEASTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G174750`
TK1151 ID	TkA01G174750
OH-1004 ID	LXL04_004287
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 39.468 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G174750

Location Chr01:44763822-44764403 (+)

Description Similar to At3g13620: Probable polyamine transporter At3g13620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13620`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release
`At3g19553`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release
`At1g31820`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release
`At1g31830`	Probable cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	No verified direct reference in this release
`At5g05630`	Cell membrane polyamine/proton symporter involved in the polyamine uptake in cells.	Natural variation in a polyamine transporter determines paraquat tolerance in Arabidopsis.2012 · DOI: 10.1073/pnas.1121406109

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004287 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0015839 cadaverine transport Biological Process

GO:0015846 polyamine transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015203 polyamine transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G31830

ath:AT3G13620

ath:AT3G19553

ath:AT5G05630

dosa:Os02g0700500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.726

Rank 1 · TkA01G174750 · TK1151

Cytoplasm0.143

Rank 2 · TkA01G174750 · TK1151

Lysosome / Vacuole0.091

Rank 3 · TkA01G174750 · TK1151

Endoplasmic reticulum0.083

Rank 4 · TkA01G174750 · TK1151

Golgi apparatus0.060

Rank 5 · TkA01G174750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHN7`	Arabidopsis thaliana	sp\|Q9LHN7\|PHSC_ARATH Probable polyamine transporter At3g13620	75.100%	Swiss-Prot	High
`Q9LH39`	Arabidopsis thaliana	sp\|Q9LH39\|PHSD_ARATH Probable polyamine transporter At3g19553	47.700%	Swiss-Prot	Medium
`Q9C6S4`	Arabidopsis thaliana	sp\|Q9C6S4\|PHSA_ARATH Probable polyamine transporter At1g31820	40.200%	Swiss-Prot	Medium
`Q9C6S5`	Arabidopsis thaliana	sp\|Q9C6S5\|PHSB_ARATH Probable polyamine transporter At1g31830	36.700%	Swiss-Prot	Medium
`Q9FFL1`	Arabidopsis thaliana	sp\|Q9FFL1\|RMV1_ARATH Polyamine transporter RMV1	39.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card