TkA01G172480 | RubberDandelionOmics

Gene overview

TkA01G172480

Reference: TK1151 Chr: Chr01 Coordinates: 44158424-44158993 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · TkA01G172480|TK1151|cDNA

ATGGCACATTTTCTTCTCCCCGTCGTTCTCTCCCTCCTCACCACCGTGTCACTAAGTTTACCGGCCACCGGAACCTACTGGAGATCCATCCGACCAAACCCATTTAAATTCAGATCAGAAAAACTCACGCACTTCCAGTTCTACTGGCACGACGTTCAAAGCGGGGCTAACCCTACCTCTGTCAACATTTTCCGACAAACACCGGTCAACACCTCCAGACCCAACGGATTTGGCCTTGTCAACATGATCGACGATCCGTT...

CDS

Download CDS FASTA

534 bp · TkA01G172480|TK1151|CDS

ATGGCACATTTTCTTCTCCCCGTCGTTCTCTCCCTCCTCACCACCGTGTCACTAAGTTTACCGGCCACCGGAACCTACTGGAGATCCATCCGACCAAACCCATTTAAATTCAGATCAGAAAAACTCACGCACTTCCAGTTCTACTGGCACGACGTTCAAAGCGGGGCTAACCCTACCTCTGTCAACATTTTCCGACAAACACCGGTCAACACCTCCAGACCCAACGGATTTGGCCTTGTCAACATGATCGACGATCCGTT...

Protein

Download Protein FASTA

177 aa · TkA01G172480|TK1151|PROTEIN

MAHFLLPVVLSLLTTVSLSLPATGTYWRSIRPNPFKFRSEKLTHFQFYWHDVQSGANPTSVNIFRQTPVNTSRPNGFGLVNMIDDPLTERPEINSKLIGRAQGMYAMNFVFLTGRYNGSTLTVLGRNPVFQKVREMPVIGGSGLFRFARGYVHATTHNLNTTSGDAIVKYSVYVLHY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G172480`
TK1151 ID	TkA01G172480
OH-1004 ID	LXL04_004318
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 97.175 / OH-1004 88.038 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G172480

Location Chr01:44158424-44158993 (-)

Description Similar to DIR19: Dirigent protein 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58170`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At3g13650`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At1g55210`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At5g49040`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At1g65870`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004318 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G55210

ath:AT1G58170

ath:AT1G65870

ath:AT3G13650

ath:AT5G49040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.424

Rank 1 · TkA01G172480 · TK1151

Lysosome / Vacuole0.197

Rank 2 · TkA01G172480 · TK1151

Endoplasmic reticulum0.117

Rank 3 · TkA01G172480 · TK1151

Cell membrane0.084

Rank 4 · TkA01G172480 · TK1151

Cytoplasm0.079

Rank 5 · TkA01G172480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03018Dirigent43-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G172480	`PF03018`	Dirigent	43	174	1.4e-48	165.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C523`	Arabidopsis thaliana	sp\|Q9C523\|DIR19_ARATH Dirigent protein 19	51.100%	Swiss-Prot	High
`Q9LID5`	Arabidopsis thaliana	sp\|Q9LID5\|DIR7_ARATH Dirigent protein 7	49.500%	Swiss-Prot	Medium
`Q9C891`	Arabidopsis thaliana	sp\|Q9C891\|DIR20_ARATH Dirigent protein 20	55.300%	Swiss-Prot	High
`Q9FI66`	Arabidopsis thaliana	sp\|Q9FI66\|DIR3_ARATH Dirigent protein 3	52.300%	Swiss-Prot	High
`Q9SS03`	Arabidopsis thaliana	sp\|Q9SS03\|DIR21_ARATH Dirigent protein 21	44.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card