Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1435 bp · TkA01G170900|TK1151|cDNA
TAATTTTAATAGCAATGCCAAGAGCTGCAAGTAGCAATCTCTAAAGCGTCTTCTAAACGTTGCTCAAGCTCTTTTGTATATATAGTGAACGGCATTTTGGGGAAATTTCCGGTAGCCACGTAAAGGCAGCCAATCGGTACGTCTTTAAAGTCTCTCCCAATTGCCGCCCTTTACATCACCAGGCGGCAACCCTCCATTTCCACCCGCTTTTCAATACAATCAATGGTGGCGGCCCTGCTCTTCCTTCTCAGGTTAGCATA...
990 bp · TkA01G170900|TK1151|CDS
ATGGAAGAGCCAGGGCAACTTAAAAGGGCATTTATTGATGCGACGGCCGGTTCTATCTCAGGAGCTATATCCCGCACAGTCACGTCGCCCCTAGATGTTATCAAAATTCGGTTTCAGGTTCAACTGGAACCAACTACTTCTTTTGCATTACTAAGCAAAAATGTATACGGGGCCTCAAAATACACAGGAATGGCTCAAGCATCCAAAGACATCTTTAGAGAGGAAGGCCTTTCAGGCTTTTGGCGTGGTAATGTCCCAGC...
Protein
Download Protein FASTA329 aa · TkA01G170900|TK1151|PROTEIN
MEEPGQLKRAFIDATAGSISGAISRTVTSPLDVIKIRFQVQLEPTTSFALLSKNVYGASKYTGMAQASKDIFREEGLSGFWRGNVPALLMVMPYTAIQFMVLHKVKTFASGSSKSEDHIHLSPYLSFMSGALAGCAATVGSYPFDLLRTILASQGEPKIYPNMRSAFVDIMNTRGFRGLYAGLSPTLVEIIPYAGLQFGTYDTFKRWTMAWNIRGLSDPTRAEESLSSFQLFLCGLAAGSCAKAVCHPLDVVKKRFQIEG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G170900 |
|---|---|
| TK1151 ID | TkA01G170900 |
| OH-1004 ID | LXL04_012352 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 93.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G170900 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:43749765-43752232 (-) | |||||||||
| Description | Similar to At5g48970: Mitochondrial thiamine diphosphate carrier 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009229 thiamine diphosphate biosynthetic process Biological Process GO:0030974 thiamine pyrophosphate transmembrane transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0015234 thiamine transmembrane transporter activity Molecular Function GO:0015297 antiporter activity Molecular Function GO:0090422 thiamine pyrophosphate transmembrane transporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G21390 ath:AT5G48970 bta:504418 zma:100194395 zma:103650800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00153Mito_carr12-110 aaPF00153Mito_carr121-208 aaPF00153Mito_carr226-324 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G170900 | PF00153 | Mito_carr | 12 | 110 | 1.8e-74 | 246.3 |
| TkA01G170900 | PF00153 | Mito_carr | 121 | 208 | 1.8e-74 | 246.3 |
| TkA01G170900 | PF00153 | Mito_carr | 226 | 324 | 1.8e-74 | 246.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.