TkA01G167160 | RubberDandelionOmics

Gene overview

TkA01G167160

Reference: TK1151 Chr: Chr01 Coordinates: 42742274-42742627 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkA01G167160|TK1151|cDNA

ATGGCAGCCGTATCCCTCCTCCTCACCCTCACCCTGATCACCTTCACCGGAGATGTCATCTCCTCCACCACTCCCTACCTCTCACCAGAAACCCTCTTTTCCAATTACGACAAGATGCTCGACTCTTTCAAAATCTTCGTCTACGCTACCCCACCCATCACCGACGGCACTATCTTCACCACCACACAAGAGTCCCAATTCTACACATCCCTCATCCAAAGTCCTTTCGTGACCGAAGACCCTAGCCAGGCTCACCTCTA...

CDS

Download CDS FASTA

354 bp · TkA01G167160|TK1151|CDS

ATGGCAGCCGTATCCCTCCTCCTCACCCTCACCCTGATCACCTTCACCGGAGATGTCATCTCCTCCACCACTCCCTACCTCTCACCAGAAACCCTCTTTTCCAATTACGACAAGATGCTCGACTCTTTCAAAATCTTCGTCTACGCTACCCCACCCATCACCGACGGCACTATCTTCACCACCACACAAGAGTCCCAATTCTACACATCCCTCATCCAAAGTCCTTTCGTGACCGAAGACCCTAGCCAGGCTCACCTCTA...

Protein

Download Protein FASTA

117 aa · TkA01G167160|TK1151|PROTEIN

MAAVSLLLTLTLITFTGDVISSTTPYLSPETLFSNYDKMLDSFKIFVYATPPITDGTIFTTTQESQFYTSLIQSPFVTEDPSQAHLYFVPFPSSLSTRNLARLIRISVLVTLSGTAH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G167160`
TK1151 ID	TkA01G167160
OH-1004 ID	LXL04_012403
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.744 / OH-1004 30.523 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G167160`
Location	Chr01:42742274-42742627 (-)
Description	Similar to At5g25310: Probable glycosyltransferase At5g25310
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012403` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009101 glycoprotein biosynthetic process Biological Process GO:0010398 xylogalacturonan metabolic process Biological Process GO:0045489 pectin biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component GO:0005768 endosome Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0009507 chloroplast Cellular Component GO:0016757 glycosyltransferase activity Molecular Function GO:0035252 UDP-xylosyltransferase activity Molecular Function
KEGG gene cross-reference	ath:AT5G11130 ath:AT5G20260 ath:AT5G25310 ath:AT5G33290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.531

Rank 1 · TkA01G167160 · TK1151

Nucleus0.175

Rank 2 · TkA01G167160 · TK1151

Golgi apparatus0.154

Rank 3 · TkA01G167160 · TK1151

Cytoplasm0.102

Rank 4 · TkA01G167160 · TK1151

Lysosome / Vacuole0.100

Rank 5 · TkA01G167160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016Exostosin_GT4741-99 aa

PF07988LMSTEN66-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G167160	`PF03016`	Exostosin_GT47	41	99	2.2e-05	24.7
TkA01G167160	`PF07988`	LMSTEN	66	82	0.29	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card