TkA01G165170 | RubberDandelionOmics

Gene overview

TkA01G165170

Reference: TK1151 Chr: Chr01 Coordinates: 42192238-42192981 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · TkA01G165170|TK1151|cDNA

ATGGTATTTGATCAGGGAATGAGAATCCCTAGAAACCTTGAAATATGGAAGCTAGGCACACTCAACTACCTAGAAGCCCTAAAACTCCAAGAAAAACTTGCATCCAAAAGAAAACTAAACAAAATCCCCGACACCCTTTTATCCCTACAACACCCACCTACCTACACACTAGGCAAACGTAAAACAGACCACAACTTACTAATCCCCGAATCCCAACTCAAAACCATGGGAGCCCAACTCCACTACACACAAAGAGGAGG...

CDS

Download CDS FASTA

744 bp · TkA01G165170|TK1151|CDS

ATGGTATTTGATCAGGGAATGAGAATCCCTAGAAACCTTGAAATATGGAAGCTAGGCACACTCAACTACCTAGAAGCCCTAAAACTCCAAGAAAAACTTGCATCCAAAAGAAAACTAAACAAAATCCCCGACACCCTTTTATCCCTACAACACCCACCTACCTACACACTAGGCAAACGTAAAACAGACCACAACTTACTAATCCCCGAATCCCAACTCAAAACCATGGGAGCCCAACTCCACTACACACAAAGAGGAGG...

Protein

Download Protein FASTA

247 aa · TkA01G165170|TK1151|PROTEIN

MVFDQGMRIPRNLEIWKLGTLNYLEALKLQEKLASKRKLNKIPDTLLSLQHPPTYTLGKRKTDHNLLIPESQLKTMGAQLHYTQRGGDITFHGPHQAILYPIISLREIGLGARKYVENLELTMVELAAMYGVKAHGQRKCETGVWIGERKIGAIGVRISSGITSHGLAFNIDPDLSYFKHIVPCGIADKDVTSLRRETETETDTDTDTVVLDEDVVQEQLVLCFVKAFGYENVVWKDKESLRLMDDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G165170`
TK1151 ID	TkA01G165170
OH-1004 ID	LXL04_004375
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 98.381 / OH-1004 27.086 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G165170

Location Chr01:42192238-42192981 (+)

Description Similar to selO: Protein adenylyltransferase SelO (Azoarcus sp. (strain BH72)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04640`	Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004375 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030145 manganese ion binding Molecular Function

GO:0070733 AMPylase activity Molecular Function

KEGG gene cross-reference

azo:azo1574

eba:ebA6654

mfa:Mfla_1788

rba:RB9953

tau:Tola_0683

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.469

Rank 1 · TkA01G165170 · TK1151

Cytoplasm0.346

Rank 2 · TkA01G165170 · TK1151

Nucleus0.151

Rank 3 · TkA01G165170 · TK1151

Plastid0.106

Rank 4 · TkA01G165170 · TK1151

Peroxisome0.100

Rank 5 · TkA01G165170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21948LplA-B_cat22-204 aa

PF03099BPL_LplA_LipB64-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G165170	`PF21948`	LplA-B_cat	22	204	8e-43	147.4
TkA01G165170	`PF03099`	BPL_LplA_LipB	64	173	0.0015	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXP7`	Arabidopsis thaliana	sp\|Q9SXP7\|LIP2M_ARATH Octanoyltransferase LIP2, mitochondrial	72.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card