TkA01G162000 | RubberDandelionOmics

Gene overview

TkA01G162000

Reference: TK1151 Chr: Chr01 Coordinates: 41412676-41414616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1248 bp · TkA01G162000|TK1151|cDNA

ATGAATGGGGTTTCCCTAGCCAAAGCAGATAATTGGGTAGATCTCAACTCTTCTTCATCTATTCAATTTCTTTATCTCAAAAACAACAATCTCACGTCATCCATGTATCGTTGGTTGGTCAAATTAACCAACAATAATCTTTTGGATCTTGATATCTCTGGCAACAGCCATTTTACAGGGTGTTTGTCTGATGACATCCAAAAGTTTTCATCTCTAACAAATCTTAACCTATATGGGAATCAATTAACCGGAATTATAAG...

CDS

Download CDS FASTA

1248 bp · TkA01G162000|TK1151|CDS

ATGAATGGGGTTTCCCTAGCCAAAGCAGATAATTGGGTAGATCTCAACTCTTCTTCATCTATTCAATTTCTTTATCTCAAAAACAACAATCTCACGTCATCCATGTATCGTTGGTTGGTCAAATTAACCAACAATAATCTTTTGGATCTTGATATCTCTGGCAACAGCCATTTTACAGGGTGTTTGTCTGATGACATCCAAAAGTTTTCATCTCTAACAAATCTTAACCTATATGGGAATCAATTAACCGGAATTATAAG...

Protein

Download Protein FASTA

415 aa · TkA01G162000|TK1151|PROTEIN

MNGVSLAKADNWVDLNSSSSIQFLYLKNNNLTSSMYRWLVKLTNNNLLDLDISGNSHFTGCLSDDIQKFSSLTNLNLYGNQLTGIISEKLWELPRLDYLNISSNYLSAISKNIGKSKLSTVDVSKNISGELPDLSSSFVSILDLSSNSFNGLIPNLPSTLRLLNLSKNKFYGGISFLCQIDDAYLHFLDLSYNDLTGPLPDCLSNFKKLIVLNLGNNNLSGRLPPSIGSLIILETLHLYKNNFYGELPLSLKNCTKLNLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G162000`
TK1151 ID	TkA01G162000
OH-1004 ID	LXL04_004346
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.400
Protein coverage (%)	TK1151 100.000 / OH-1004 77.278 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G162000`
Location	Chr01:41412676-41414616 (+)
Description	Similar to EIX2: Receptor-like protein EIX2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004346` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0007165 signal transduction Biological Process GO:0050832 defense response to fungus Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009536 plastid Cellular Component
KEGG gene cross-reference	ath:AT2G33060 ath:AT5G40170 sly:543900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.851

Rank 1 · TkA01G162000 · TK1151

Endoplasmic reticulum0.097

Rank 2 · TkA01G162000 · TK1151

Cytoplasm0.056

Rank 3 · TkA01G162000 · TK1151

Nucleus0.037

Rank 4 · TkA01G162000 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA01G162000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29247LRR_MHP1-HER1-GIP315-54 aa

PF23598LRR_1416-53 aa

PF13855LRR_819-51 aa

PF00560LRR_120-38 aa

PF12799LRR_420-56 aa

PF23211LRR_LRWD129-49 aa

PF24758LRR_At5g5637037-104 aa

PF29594LRR_SKP243-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G162000	`PF29247`	LRR_MHP1-HER1-GIP3	15	54	9.3	6.0
TkA01G162000	`PF23598`	LRR_14	16	53	1.3e-09	38.0
TkA01G162000	`PF13855`	LRR_8	19	51	1.2e-11	44.9
TkA01G162000	`PF00560`	LRR_1	20	38	7.2e-21	70.5
TkA01G162000	`PF12799`	LRR_4	20	56	1e-12	48.6
TkA01G162000	`PF23211`	LRR_LRWD1	29	49	8.0	6.8
TkA01G162000	`PF24758`	LRR_At5g56370	37	104	0.00062	20.2
TkA01G162000	`PF29594`	LRR_SKP2	43	212	0.95	9.4
TkA01G162000	`PF00560`	LRR_1	46	68	7.2e-21	70.5
TkA01G162000	`PF13855`	LRR_8	47	106	1.2e-11	44.9
TkA01G162000	`PF29247`	LRR_MHP1-HER1-GIP3	64	104	9.3	6.0
TkA01G162000	`PF23598`	LRR_14	65	141	1.3e-09	38.0
TkA01G162000	`PF00560`	LRR_1	71	92	7.2e-21	70.5
TkA01G162000	`PF12799`	LRR_4	71	110	1e-12	48.6
TkA01G162000	`PF23211`	LRR_LRWD1	72	167	8.0	6.8
TkA01G162000	`PF12799`	LRR_4	94	135	1e-12	48.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card