TkA01G161840 | RubberDandelionOmics

Gene overview

TkA01G161840

Reference: TK1151 Chr: Chr01 Coordinates: 41369315-41372635 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3197 bp · TkA01G161840|TK1151|cDNA

CAAAAATCAGTAATACTTTCATTTACGTCATGCATCCTTGTGTTTTTATAATTTTCTCCTTTCTCTTGCTACTCCTTGAGACTGCCATTGCCGACCAATTGGTGGCAGTGGAAGCTGTTAACAAGAACTGCTCTGATGTGGAGAGACATGCTCTCCTTGATTTCAAAGCTGGCCTTCAAGATCCCAAAGGCGCTCTCTCTACATGGACAACCGAAGATCATGATTGCTGTTCATGGCCAGGAGTCAAATGTAAGAACAAT...

CDS

Download CDS FASTA

2184 bp · TkA01G161840|TK1151|CDS

ATGGATGGGGTTTCCCTAGCCAAAGCAGATAATTGGGTAGATGTAATTTCGAGTCTCCCAAATTTGATAGAGTTACGTTTAGATGGATGTGAGCTCTCACAGGTGAAGTATCCAAATTCTTCATTTCTCAACTCTTCTTCATCTATTCAATCCCTTTCTCTCAAAAACAACAATCTCACGTCATCCATGTATCGTTGGTTGGTCAAATTAACCAGCAAGAATCTTTTGTATCTTGATATCTCTAGCAACAGGTTGGATGA...

Protein

Download Protein FASTA

727 aa · TkA01G161840|TK1151|PROTEIN

MDGVSLAKADNWVDVISSLPNLIELRLDGCELSQVKYPNSSFLNSSSSIQSLSLKNNNLTSSMYRWLVKLTSKNLLYLDISSNRLDEIPTYFGNLCSLNTLQFDNNFVAVKFSDFLNNLSGCTALTLQFLFASKSHFTGSLSDNIQKFSSLRWLYLSDNQLEGTISEKLWELPSLEHLNIASNYLRGAISKNIGKSKLSVIDLSENPLEGVPSTTHMSNLSYVVGIRLRSCKLGPHFPTWIQKLEKISYLDISNTGISDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G161840`
TK1151 ID	TkA01G161840
OH-1004 ID	LXL04_004350
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.700
Protein coverage (%)	TK1151 99.862 / OH-1004 73.168 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G161840`
Location	Chr01:41369315-41372635 (+)
Description	Similar to EIX2: Receptor-like protein EIX2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004350` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0007165 signal transduction Biological Process GO:0050832 defense response to fungus Biological Process GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT3G05370 sly:543900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.863

Rank 1 · TkA01G161840 · TK1151

Endoplasmic reticulum0.092

Rank 2 · TkA01G161840 · TK1151

Cytoplasm0.053

Rank 3 · TkA01G161840 · TK1151

Nucleus0.038

Rank 4 · TkA01G161840 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA01G161840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29594LRR_SKP29-84 aa

PF12799LRR_414-34 aa

PF13855LRR_815-32 aa

PF23598LRR_1415-252 aa

PF24758LRR_At5g5637017-87 aa

PF13855LRR_820-71 aa

PF12799LRR_420-60 aa

PF13516LRR_620-32 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G161840	`PF29594`	LRR_SKP2	9	84	0.06	13.3
TkA01G161840	`PF12799`	LRR_4	14	34	8.5e-23	80.6
TkA01G161840	`PF13855`	LRR_8	15	32	1.4e-34	118.4
TkA01G161840	`PF23598`	LRR_14	15	252	9e-23	81.3
TkA01G161840	`PF24758`	LRR_At5g56370	17	87	0.025	14.9
TkA01G161840	`PF13855`	LRR_8	20	71	1.4e-34	118.4
TkA01G161840	`PF12799`	LRR_4	20	60	8.5e-23	80.6
TkA01G161840	`PF13516`	LRR_6	20	32	0.49	11.3
TkA01G161840	`PF00560`	LRR_1	21	34	2.3e-42	134.5
TkA01G161840	`PF25013`	LRR_Zer-1	29	87	5.7e-10	40.2
TkA01G161840	`PF27087`	LRR_TMOD-LMOD	39	74	0.023	15.0
TkA01G161840	`PF13516`	LRR_6	46	61	0.49	11.3
TkA01G161840	`PF00560`	LRR_1	48	66	2.3e-42	134.5
TkA01G161840	`PF12799`	LRR_4	48	61	8.5e-23	80.6
TkA01G161840	`PF23211`	LRR_LRWD1	48	107	0.00025	21.5
TkA01G161840	`PF23952`	LRR_EndoS	50	83	4.8	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card