TkA01G159320 | RubberDandelionOmics

Gene overview

TkA01G159320

Reference: TK1151 Chr: Chr01 Coordinates: 40752815-40773206 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2996 bp · TkA01G159320|TK1151|cDNA

CTTCTATATATATTACAACGTCAGAAAGAACCTATGACATATGCTCAACCCAACACGACAAATAACATGCTGAAACCTCAACTCCACCACCACCACTCAAACTCTACTCAATCCTTACTCAAATGGCAGCACAAGGCATTTGTCGCCGGAGATGCCCACACTTGCGGTGGCGACAGTGGAATCGCCGCCGGTTTCCTTTTTCTCCACAAGCTTTCTTCAAATTTACCCATTAAACGCAACGGCTTCCATGCAGCATGGCC...

CDS

Download CDS FASTA

2787 bp · TkA01G159320|TK1151|CDS

ATGACATATGCTCAACCCAACACGACAAATAACATGCTGAAACCTCAACTCCACCACCACCACTCAAACTCTACTCAATCCTTACTCAAATGGCAGCACAAGGCATTTGTCGCCGGAGATGCCCACACTTGCGGTGGCGACAGTGGAATCGCCGCCGGTTTCCTTTTTCTCCACAAGCTTTCTTCAAATTTACCCATTAAACGCAACGGCTTCCATGCAGCATGGCCATCCCATCAGATAAAAGCCATCGCTGCCGACAA...

Protein

Download Protein FASTA

928 aa · TkA01G159320|TK1151|PROTEIN

MTYAQPNTTNNMLKPQLHHHHSNSTQSLLKWQHKAFVAGDAHTCGGDSGIAAGFLFLHKLSSNLPIKRNGFHAAWPSHQIKAIAADKSIATTTTKVKAIITVQVTMGGLISSIGLTRGLDDIADLLGKSLLLELVAAEVDHSTGLPKDTIKHYAHRSGIDMKDVKYLAEFEVPDEFGQIGAILIENEHHKEMYLEKIELKGFSDGTITINPNSWVHSKFDNPEKRVFFTNKSYLPSQTPSGLKDLREKDLASLRGDGVPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G159320`
TK1151 ID	TkA01G159320
OH-1004 ID	LXL04_004391
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G159320

Location Chr01:40752815-40773206 (+)

Description Similar to LOX2.1: Linoleate 13S-lipoxygenase 2-1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45140`	13S-lipoxygenase that can use linolenic acid as substrates.	A chloroplast lipoxygenase is required for wound-induced jasmonic acid accumulation in Arabidopsis.1995 · DOI: 10.1073/pnas.92.19.8675

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0509100`	Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004391 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0034440 lipid oxidation Biological Process

GO:0051707 response to other organism Biological Process

KEGG gene cross-reference

ag:CAD45187

ath:AT3G45140

dosa:Os08g0509100

sot:102596122

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.901

Rank 1 · TkA01G159320 · TK1151

Cell membrane0.054

Rank 2 · TkA01G159320 · TK1151

Cytoplasm0.053

Rank 3 · TkA01G159320 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA01G159320 · TK1151

Lysosome / Vacuole0.038

Rank 5 · TkA01G159320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01477PLAT164-228 aa

PF00305Lipoxygenase241-911 aa

PF03321GH3490-531 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G159320	`PF01477`	PLAT	164	228	2.6e-09	38.5
TkA01G159320	`PF00305`	Lipoxygenase	241	911	7.1e-299	993.8
TkA01G159320	`PF03321`	GH3	490	531	0.067	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P38418`	Arabidopsis thaliana	sp\|P38418\|LOX2_ARATH Lipoxygenase 2, chloroplastic	57.200%	Swiss-Prot	High
`Q84YK8`	Oryza sativa subsp. japonica	sp\|Q84YK8\|LOXC2_ORYSJ Probable lipoxygenase 8, chloroplastic	55.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card