TkA01G158590 | RubberDandelionOmics

Gene overview

TkA01G158590

Reference: TK1151 Chr: Chr01 Coordinates: 40535954-40536628 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA01G158590|TK1151|cDNA

GAAGATCAATTCTCGAAGCTACATCCATGTTTTCATACAAACACAAGGATTGGGATTATTGGGGCGGGGCCCAGTGGGTTATCGGCTGCATATGCACTATGCAAACTTGGGTATTCTAATGTCACTGTTTTGGAGAAACATTGGTCTGTAGGTGGCATGTGTGAATCCGTAGATATTGAAGGAGGTATATACGATTTGGGAGGACAAGTCCTAGCTGCAAATAGTGCTCCCACCATCTTTCACCTGGCAAAAGAAATTGG...

CDS

Download CDS FASTA

480 bp · TkA01G158590|TK1151|CDS

GAAGATCAATTCTCGAAGCTACATCCATGTTTTCATACAAACACAAGGATTGGGATTATTGGGGCGGGGCCCAGTGGGTTATCGGCTGCATATGCACTATGCAAACTTGGGTATTCTAATGTCACTGTTTTGGAGAAACATTGGTCTGTAGGTGGCATGTGTGAATCCGTAGATATTGAAGGAGGTATATACGATTTGGGAGGACAAGTCCTAGCTGCAAATAGTGCTCCCACCATCTTTCACCTGGCAAAAGAAATTGG...

Protein

Download Protein FASTA

160 aa · TkA01G158590|TK1151|PROTEIN

EDQFSKLHPCFHTNTRIGIIGAGPSGLSAAYALCKLGYSNVTVLEKHWSVGGMCESVDIEGGIYDLGGQVLAANSAPTIFHLAKEIGAETEELDDHKFAIIDTTGKYNDTKVIEDYISIISLTLKLQDEANATGRIGVHAISDIASEPTPSFLRSNGLES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G158590`
TK1151 ID	TkA01G158590
OH-1004 ID	LXL04_004395
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 6.993 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G158590`
Location	Chr01:40535954-40536628 (-)
Description	Similar to fadD28: Long-chain-fatty-acid--AMP ligase FadD28 (Mycobacterium marinum (strain ATCC BAA-535 / M)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004395` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006633 fatty acid biosynthetic process Biological Process GO:0008610 lipid biosynthetic process Biological Process GO:0051701 biological process involved in interaction with host Biological Process GO:0052170 symbiont-mediated suppression of host innate immune response Biological Process GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0004321 fatty-acyl-CoA synthase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0016874 ligase activity Molecular Function GO:0070566 adenylyltransferase activity Molecular Function
KEGG gene cross-reference	ag:AAS98774 mmi:MMAR_1765 mmi:MMAR_1777 mtc:MT3011 mtu:Rv2941 mtv:RVBD_2941 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.413

Rank 1 · TkA01G158590 · TK1151

Peroxisome0.200

Rank 2 · TkA01G158590 · TK1151

Nucleus0.169

Rank 3 · TkA01G158590 · TK1151

Extracellular0.100

Rank 4 · TkA01G158590 · TK1151

Plastid0.096

Rank 5 · TkA01G158590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01494FAD_binding_315-47 aa

PF01946Thi416-53 aa

PF00070Pyr_redox16-47 aa

PF01266DAO17-51 aa

PF07992Pyr_redox_217-109 aa

PF06100MCRA17-110 aa

PF03486HI0933_like17-51 aa

PF01134GIDA17-53 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G158590	`PF01494`	FAD_binding_3	15	47	0.00015	21.8
TkA01G158590	`PF01946`	Thi4	16	53	2e-06	27.9
TkA01G158590	`PF00070`	Pyr_redox	16	47	0.001	20.3
TkA01G158590	`PF01266`	DAO	17	51	6.9e-07	29.8
TkA01G158590	`PF07992`	Pyr_redox_2	17	109	0.00036	20.8
TkA01G158590	`PF06100`	MCRA	17	110	0.0053	16.3
TkA01G158590	`PF03486`	HI0933_like	17	51	0.011	16.0
TkA01G158590	`PF01134`	GIDA	17	53	0.022	14.6
TkA01G158590	`PF13450`	NAD_binding_8	19	85	1.2e-15	58.2
TkA01G158590	`PF13738`	Pyr_redox_3	19	50	9.2e-06	25.8
TkA01G158590	`PF00890`	FAD_binding_2	19	56	0.0011	18.9
TkA01G158590	`PF12831`	FAD_oxidored	19	54	0.0035	17.4
TkA01G158590	`PF13454`	NAD_binding_9	19	50	0.013	16.2
TkA01G158590	`PF01593`	Amino_oxidase	25	116	2.7e-12	47.5
TkA01G158590	`PF13454`	NAD_binding_9	89	107	0.013	16.2
TkA01G158590	`PF13738`	Pyr_redox_3	94	113	9.2e-06	25.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card