TkA01G156790 | RubberDandelionOmics

Gene overview

TkA01G156790

Reference: TK1151 Chr: Chr01 Coordinates: 40080998-40084345 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2106 bp · TkA01G156790|TK1151|cDNA

CTAGAAGCTACCTGGCTCGCTCGCTCACTCACTCACCCAACATCTTCTCCACATGCTCCCATCCCTTTATTCCATTGGTAACAATGACAAATTCTTTTGGATTTCACTATTCTCTCTCTTCTCCCCCCCTTTCACATCGATTTCTGGTATTCCTGCAACCCTCTAATCTTCTTCGCCACTTGGAACCCAAATCCAACCGTTGATTCATTCGATTTCATTCCTCCTTCTGTTTATAATCCCTTCTGTAATCTTCTTCGCGT...

CDS

Download CDS FASTA

1710 bp · TkA01G156790|TK1151|CDS

ATGGCTACCACCAGCACGTCGGAGCAATCCAATTCCAACGCCTATCAAAGAGAAGACCGGCGAACCGCCATCGCCGGTAACAGTGAGGTGAGCAAGCAGGAGATTCAAGCGGCGATTGCTAAAGCGGTGGAGCTCAGAGCGCTTCATGCTGCTCTGTTACAGAGCAACAGTCCGGCACATCTCCGGTTGCCGTCGGCGTCTCCGGTTTCACGGCATGCTTCCCAACTATCTGCTCAGGATTACCCTGTTTTCACCCCTAG...

Protein

Download Protein FASTA

569 aa · TkA01G156790|TK1151|PROTEIN

MATTSTSEQSNSNAYQREDRRTAIAGNSEVSKQEIQAAIAKAVELRALHAALLQSNSPAHLRLPSASPVSRHASQLSAQDYPVFTPSYDDVPRSQNFPSCWDECSVNGGNTDDLRFLSDYKNPNTSSRTLLPPELLNILPHTCPSDNDQNSVTASTTNHHTLLRASPGTETSKSRRNSLGDFRSVSSCNKCKPATLSTNKYSNLVVPMTDSHSLFQSHSKPKSGISLSWLFPRLKKKHNVKSSPTGMESDEVSVRKMNSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G156790`
TK1151 ID	TkA01G156790
OH-1004 ID	LXL04_004399
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 89.731 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G156790

Location Chr01:40080998-40084345 (+)

Description Similar to IRKI: IRK-interacting protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12900`	IRK-interacting protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004399 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G12900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · TkA01G156790 · TK1151

Nucleus0.354

Rank 2 · TkA01G156790 · TK1151

Cell membrane0.312

Rank 3 · TkA01G156790 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA01G156790 · TK1151

Golgi apparatus0.043

Rank 5 · TkA01G156790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13851GAS256-321 aa

PF30088OM45264-337 aa

PF29874Wac264-321 aa

PF01025GrpE266-321 aa

PF29874Wac338-385 aa

PF24994GIL1_IRKI_C512-562 aa

PF01025GrpE517-558 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G156790	`PF13851`	GAS	256	321	0.0017	18.5
TkA01G156790	`PF30088`	OM45	264	337	0.069	13.6
TkA01G156790	`PF29874`	Wac	264	321	0.17	12.5
TkA01G156790	`PF01025`	GrpE	266	321	0.0069	16.8
TkA01G156790	`PF29874`	Wac	338	385	0.17	12.5
TkA01G156790	`PF24994`	GIL1_IRKI_C	512	562	8.5e-07	29.6
TkA01G156790	`PF01025`	GrpE	517	558	0.0069	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXU9`	Arabidopsis thaliana	sp\|Q9LXU9\|IRKI_ARATH IRK-interacting protein	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card