TkA01G151940 | RubberDandelionOmics

Gene overview

TkA01G151940

Reference: TK1151 Chr: Chr01 Coordinates: 38604116-38605684 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1087 bp · TkA01G151940|TK1151|cDNA

CGAAGAAAATACGTGGACGTAAGTGACGGTAGAGAACCGGGACTAAAACGCCAACGTGTAATCGACCAAACCTCATCATACTACACAACCCCACCCCCTTCAACCTACCTCTACACCCCCACCACCTACCCCTACACCCCCCACCCCCCCACCTTCCCCCTCGTAAAATTACGCGGCCTACCCTTCGACTGCTCCGAATCCGACATTTCCGAATTCCTCCACGGCCTCGACATCGTCGACATCTTATTCGTCCACAAACA...

CDS

Download CDS FASTA

768 bp · TkA01G151940|TK1151|CDS

CGAAGAAAATACGTGGACGTAAGTGACGGTAGAGAACCGGGACTAAAACGCCAACGTGTAATCGACCAAACCTCATCATACTACACAACCCCACCCCCTTCAACCTACCTCTACACCCCCACCACCTACCCCTACACCCCCCACCCCCCCACCTTCCCCCTCGTAAAATTACGCGGCCTACCCTTCGACTGCTCCGAATCCGACATTTCCGAATTCCTCCACGGCCTCGACATCGTCGACATCTTATTCGTCCACAAACA...

Protein

Download Protein FASTA

255 aa · TkA01G151940|TK1151|PROTEIN

RRKYVDVSDGREPGLKRQRVIDQTSSYYTTPPPSTYLYTPTTYPYTPHPPTFPLVKLRGLPFDCSESDISEFLHGLDIVDILFVHKHNKFAGEAFCLLGYPFQVEYALQRNRQNIGEDTLEVFRSKRDEYYKAIANEVDGNGSSTRGGGGGGRRSWSPRRGGGVRANVLRMRGLPFSAGKDDIIDFFKEFELSEDLIHMTYNSEGRPTGEALVEFASVDDSKAALAKDRMSLGSRYIELFMSSPEELKDAVLRGR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G151940`
TK1151 ID	TkA01G151940
OH-1004 ID	LXL04_013895
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.800
Protein coverage (%)	TK1151 97.647 / OH-1004 58.166 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G151940`
Location	Chr01:38604116-38605684 (-)
Description	Similar to Hnrnph2: Heterogeneous nuclear ribonucleoprotein H2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013895` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0043484 regulation of RNA splicing Biological Process GO:0005654 nucleoplasm Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	pon:100172043 rno:308650 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.777

Rank 1 · TkA01G151940 · TK1151

Cytoplasm0.381

Rank 2 · TkA01G151940 · TK1151

Cell membrane0.036

Rank 3 · TkA01G151940 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA01G151940 · TK1151

Mitochondrion0.024

Rank 5 · TkA01G151940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28442DUF840053-73 aa

PF28441RRM_1155-133 aa

PF00076RRM_157-117 aa

PF28442DUF8400110-130 aa

PF28442DUF8400166-247 aa

PF28441RRM_11169-249 aa

PF00076RRM_1170-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G151940	`PF28442`	DUF8400	53	73	0.00018	22.3
TkA01G151940	`PF28441`	RRM_11	55	133	1.4e-33	115.8
TkA01G151940	`PF00076`	RRM_1	57	117	2e-12	47.5
TkA01G151940	`PF28442`	DUF8400	110	130	0.00018	22.3
TkA01G151940	`PF28442`	DUF8400	166	247	0.00018	22.3
TkA01G151940	`PF28441`	RRM_11	169	249	1.4e-33	115.8
TkA01G151940	`PF00076`	RRM_1	170	237	2e-12	47.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card