TkA01G147380 | RubberDandelionOmics

Gene overview

TkA01G147380

Reference: TK1151 Chr: Chr01 Coordinates: 37278827-37282110 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1737 bp · TkA01G147380|TK1151|cDNA

GGACTATATAACCCGCCGTACAAGAGAACAGGAGCTGCTCAAAAGGCTTTGGAAAAGGAATGAGCAACTTCGGCAACGGCAAAGGGAAGCCGATGAACGGGGACGACGACGACGACGAAGATGAAGGAAACGAGAGAGACCTCGAAGCTTGGGAGAGAGCATACGCAGACGAGCGGTCCTGGGAATCATTACAAGAAGATGAATCTGGACTCCTTCGGCCAATCGATAACCAAGCTTTACATCACGCTCAATATCGCCGC...

CDS

Download CDS FASTA

1263 bp · TkA01G147380|TK1151|CDS

ATGAGCAACTTCGGCAACGGCAAAGGGAAGCCGATGAACGGGGACGACGACGACGACGAAGATGAAGGAAACGAGAGAGACCTCGAAGCTTGGGAGAGAGCATACGCAGACGAGCGGTCCTGGGAATCATTACAAGAAGATGAATCTGGACTCCTTCGGCCAATCGATAACCAAGCTTTACATCACGCTCAATATCGCCGCCGTCTCCGTTCACTCTCCTCGGCATCCGCCGCCTCACGTATTCAAAAAGGCCTCATTCG...

Protein

Download Protein FASTA

420 aa · TkA01G147380|TK1151|PROTEIN

MSNFGNGKGKPMNGDDDDDEDEGNERDLEAWERAYADERSWESLQEDESGLLRPIDNQALHHAQYRRRLRSLSSASAASRIQKGLIRYLYLVIDLSRAAGEMDLRPSRMVVVAKQVEAFVREFFDQNPLSQIGLITIKNGVAQCLTDLGGSPESHIKALMGKLGCAGEASLQNALELVHEQLDQIPSYGHREVIILYSALSTCDPGDVLETIQKCKKSKIRCSVIGLSAEIYICKYLCQETGGLYSVALDEAHLKELILE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G147380`
TK1151 ID	TkA01G147380
OH-1004 ID	LXL04_004459
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G147380

Location Chr01:37278827-37282110 (-)

Description Similar to GTF2H2: General transcription factor IIH subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05055`	Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.	Arabidopsis homologue of human transcription factor IIH/nucleotide excision repair factor p44 can function in transcription and DNA repair and interacts with AtXPD.2006 · DOI: 10.1111/j.1365-313x.2006.02705.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004459 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002031 G protein-coupled receptor internalization Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0009411 response to UV Biological Process

GO:0000438 core TFIIH complex portion of holo TFIIH complex Cellular Component

GO:0000439 transcription factor TFIIH core complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005669 transcription factor TFIID complex Cellular Component

KEGG gene cross-reference

ath:AT1G05055

bta:511829

ddi:DDB_G0272362

hsa:2966

rno:294693

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.439

Rank 1 · TkA01G147380 · TK1151

Nucleus0.398

Rank 2 · TkA01G147380 · TK1151

Golgi apparatus0.166

Rank 3 · TkA01G147380 · TK1151

Lysosome / Vacuole0.162

Rank 4 · TkA01G147380 · TK1151

Cell membrane0.114

Rank 5 · TkA01G147380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13519VWA_263-85 aa

PF00092VWA89-228 aa

PF13519VWA_290-197 aa

PF04056Ssl192-282 aa

PF01807Zn_ribbon_DnaG197-229 aa

PF27618Zn_ribbon_GTF2H2214-227 aa

PF01485IBR302-315 aa

PF07975C1_4304-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G147380	`PF13519`	VWA_2	63	85	1e-09	39.7
TkA01G147380	`PF00092`	VWA	89	228	0.00026	21.9
TkA01G147380	`PF13519`	VWA_2	90	197	1e-09	39.7
TkA01G147380	`PF04056`	Ssl1	92	282	1.4e-86	290.0
TkA01G147380	`PF01807`	Zn_ribbon_DnaG	197	229	0.18	12.3
TkA01G147380	`PF27618`	Zn_ribbon_GTF2H2	214	227	3.2e-07	30.5
TkA01G147380	`PF01485`	IBR	302	315	0.002	18.9
TkA01G147380	`PF07975`	C1_4	304	315	6.8e-18	65.4
TkA01G147380	`PF18439`	zf_UBZ	304	314	5.9	7.4
TkA01G147380	`PF27618`	Zn_ribbon_GTF2H2	306	336	3.2e-07	30.5
TkA01G147380	`PF01807`	Zn_ribbon_DnaG	334	371	0.18	12.3
TkA01G147380	`PF01485`	IBR	358	407	0.002	18.9
TkA01G147380	`PF07975`	C1_4	364	412	6.8e-18	65.4
TkA01G147380	`PF18439`	zf_UBZ	383	391	5.9	7.4
TkA01G147380	`PF27618`	Zn_ribbon_GTF2H2	384	389	3.2e-07	30.5
TkA01G147380	`PF18439`	zf_UBZ	390	403	5.9	7.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVN9`	Arabidopsis thaliana	sp\|Q9ZVN9\|TF2H2_ARATH General transcription factor IIH subunit 2	79.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card