TkA01G140800 | RubberDandelionOmics

Gene overview

TkA01G140800

Reference: TK1151 Chr: Chr01 Coordinates: 35736963-35741473 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2858 bp · TkA01G140800|TK1151|cDNA

GGATCGTCGAAGAGAGATTCGGATACATCCAATTAATGGACGTCAAATCTATGTGGCCCCTGGAAAAAGGTAGATAACCAGATACTGTTTTCGTAATAAATTAGCCGACTAGGGGTGTTTTCTTAAACCCAAAATCCTTTTCTGCCATCCAACCCCGTCAGTCTCCGCCGCAGGCAACCAAATATCACCCGTCAAATCTTAACGTCGTTAAATCTCTAGGTCTTTGAGAACCGAGAAGTCTAAAAAGCCAACTGGACTTA...

CDS

Download CDS FASTA

2115 bp · TkA01G140800|TK1151|CDS

ATGGAGATGAACAATCTAAGAACGGAGTCTCACGTAGCCCAGAAAAGCCGGCGACATAAGTTGAGATTTCAGCAAAACTCCGACGAACATTTATCACAAGATCCTCACTTCGAAGTTCATAGACCCAGATACGGATCCGTGTCATACGATCCGAATGTATTCCCCTCCGAAATGCTTCATTCCGTTGCTAGTAATCCACAACTGTTGATACCTCCCAACCATGCTTTTGTTTCCCACGAACAAGATTCGGGTTCTGGTTC...

Protein

Download Protein FASTA

704 aa · TkA01G140800|TK1151|PROTEIN

MEMNNLRTESHVAQKSRRHKLRFQQNSDEHLSQDPHFEVHRPRYGSVSYDPNVFPSEMLHSVASNPQLLIPPNHAFVSHEQDSGSGSSPATFPPSLSSKVIGDTPQNGGNWKSVVSSQNQLQVSGDWNVVSYSNVASMSIDQNQTNSNSPMVVDGGPASSKPSYGYTHDLQNIHLSDQKNYPGQVPAFSSTPYYHNTLQEVVTSATVGTHVHQGKNFLEINHQIPCWMNPSDQLGFRERTNENNCITQGLSLSLSSVPQA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G140800`
TK1151 ID	TkA01G140800
OH-1004 ID	LXL04_004503
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G140800

Location Chr01:35736963-35741473 (+)

Description Similar to BLH8: BEL1-like homeodomain protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27990`	Required for specifying floral primordia and establishing early internode patterning events during inflorescence development.	No verified direct reference in this release
`At5g02030`	Transcription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation.	No verified direct reference in this release
`At2g35940`	BEL1-like homeodomain protein 1.	No verified direct reference in this release
`At4g36870`	Transcription factor that establishes leaf shape by repressing growth in specific subdomains of the leaf.	No verified direct reference in this release
`At2g23760`	Transcription factor that establishes leaf shape by repressing growth in specific subdomains of the leaf.	The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.2007 · DOI: 10.1105/tpc.106.048769

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004503 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007389 pattern specification process Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010076 maintenance of floral meristem identity Biological Process

GO:0010077 maintenance of inflorescence meristem identity Biological Process

GO:0010089 xylem development Biological Process

GO:0010154 fruit development Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010229 inflorescence development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G75410

ath:AT2G16400

ath:AT2G27990

ath:AT4G34610

ath:AT5G02030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · TkA01G140800 · TK1151

Cytoplasm0.114

Rank 2 · TkA01G140800 · TK1151

Cell membrane0.028

Rank 3 · TkA01G140800 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA01G140800 · TK1151

Plastid0.011

Rank 5 · TkA01G140800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07526POX310-446 aa

PF00046Homeodomain448-474 aa

PF05920Homeobox_KN518-557 aa

PF00046Homeodomain525-557 aa

PF07526POX582-605 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G140800	`PF07526`	POX	310	446	3.8e-38	131.8
TkA01G140800	`PF00046`	Homeodomain	448	474	1.2e-08	35.4
TkA01G140800	`PF05920`	Homeobox_KN	518	557	6.4e-20	71.4
TkA01G140800	`PF00046`	Homeodomain	525	557	1.2e-08	35.4
TkA01G140800	`PF07526`	POX	582	605	3.8e-38	131.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJJ3`	Arabidopsis thaliana	sp\|Q9SJJ3\|BLH8_ARATH BEL1-like homeodomain protein 8	43.700%	Swiss-Prot	Medium
`Q9LZM8`	Arabidopsis thaliana	sp\|Q9LZM8\|BLH9_ARATH BEL1-like homeodomain protein 9	47.700%	Swiss-Prot	Low
`Q9SJ56`	Arabidopsis thaliana	sp\|Q9SJ56\|BLH1_ARATH BEL1-like homeodomain protein 1	45.400%	Swiss-Prot	Low
`Q9SW80`	Arabidopsis thaliana	sp\|Q9SW80\|BLH2_ARATH BEL1-like homeodomain protein 2	38.300%	Swiss-Prot	Medium
`Q94KL5`	Arabidopsis thaliana	sp\|Q94KL5\|BLH4_ARATH BEL1-like homeodomain protein 4	43.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card