Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2091 bp · TkA01G131610|TK1151|cDNA
ATGTCAGGTGAAATTCCTCAAAATCCTGCTCCTACTGGTTCTAATTCCAGTGTTTCACCTATTGATGATCGGCTTCATCCTTATTATCTGCATCATTCAGATAATCCTGGTTTTGTACTTGTTTCACAAGCTCTTACCGTTGATAACTATCAGTCATGGAATCAAGCGATGCTCATTGCTTTATCAGTCAAAAACAAACTCGGATTCATAGATGGATCACTACCGAGGCCTGCTACCACCGATGCAAATCTATATACTGC...
2091 bp · TkA01G131610|TK1151|CDS
ATGTCAGGTGAAATTCCTCAAAATCCTGCTCCTACTGGTTCTAATTCCAGTGTTTCACCTATTGATGATCGGCTTCATCCTTATTATCTGCATCATTCAGATAATCCTGGTTTTGTACTTGTTTCACAAGCTCTTACCGTTGATAACTATCAGTCATGGAATCAAGCGATGCTCATTGCTTTATCAGTCAAAAACAAACTCGGATTCATAGATGGATCACTACCGAGGCCTGCTACCACCGATGCAAATCTATATACTGC...
Protein
Download Protein FASTA696 aa · TkA01G131610|TK1151|PROTEIN
MSGEIPQNPAPTGSNSSVSPIDDRLHPYYLHHSDNPGFVLVSQALTVDNYQSWNQAMLIALSVKNKLGFIDGSLPRPATTDANLYTAWMRNNNLVISWILNSVSKEISASIMFAESALDIWNDLKDRFQQNDGPRVFQIKREITNLNKNQDSISVYFTKLKSLWEELSNFRPRCSCGKCECNGVKEIEKYFQNEHVMNFLMGLNDSFTQTRSQILLMDPMPPINRVFSLVTQEERQKIISNDGQNAMTLLAKANQATQNN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G131610 |
|---|---|
| TK1151 ID | TkA01G131610 |
| OH-1004 ID | LXL04_005843 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 40.700 |
| Protein coverage (%) | TK1151 92.098 / OH-1004 27.171Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G131610 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:33274619-33276828 (-) | |||||||||
| Description | Similar to SBT: Subtilisin-like protease | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0005615 extracellular space Cellular Component GO:0048046 apoplast Cellular Component GO:0004252 serine-type endopeptidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | No functional description available |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14244Retrotran_gag_331-78 aaPF14223Retrotran_gag_259-169 aaPF17241Retrotran_gag_492-147 aaPF00665rve95-134 aaPF14223Retrotran_gag_2196-235 aaPF13976gag_pre-integrs275-284 aaPF22936Pol_BBD345-415 aaPF13976gag_pre-integrs447-507 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G131610 | PF14244 | Retrotran_gag_3 | 31 | 78 | 7.1e-21 | 74.5 |
| TkA01G131610 | PF14223 | Retrotran_gag_2 | 59 | 169 | 2.3e-10 | 41.2 |
| TkA01G131610 | PF17241 | Retrotran_gag_4 | 92 | 147 | 0.0088 | 16.5 |
| TkA01G131610 | PF00665 | rve | 95 | 134 | 5e-09 | 37.1 |
| TkA01G131610 | PF14223 | Retrotran_gag_2 | 196 | 235 | 2.3e-10 | 41.2 |
| TkA01G131610 | PF13976 | gag_pre-integrs | 275 | 284 | 2.7e-09 | 37.4 |
| TkA01G131610 | PF22936 | Pol_BBD | 345 | 415 | 9.8e-14 | 52.2 |
| TkA01G131610 | PF13976 | gag_pre-integrs | 447 | 507 | 2.7e-09 | 37.4 |
| TkA01G131610 | PF00665 | rve | 522 | 618 | 5e-09 | 37.1 |
| TkA01G131610 | PF06703 | SPC25 | 573 | 613 | 0.14 | 12.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.