TkA01G127600 | RubberDandelionOmics

Gene overview

TkA01G127600

Reference: TK1151 Chr: Chr01 Coordinates: 32216283-32217506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · TkA01G127600|TK1151|cDNA

ATGCTCAAGACCAATTTCGATAACTACCCGAAAGGAAAAGCTTTCTCGGCGATCCTCGGCGACCTTCTCGGCCGAGGGATTTTCAACGTCGACGGTAAGTGCTGGAGGTTTCAGAGGAAGATGGCGAGTTTGGAACTTGGGAGTGTGTCTATCAGATCGCACGCTTTGAACGTTGTGGTGGATGAGATTGAATCCAGGCTTATTCCGTTCTTTTCATCGGTCGCCGACAACAACGACGGCTCTGTTTTGGACCTGCAAGA...

CDS

Download CDS FASTA

849 bp · TkA01G127600|TK1151|CDS

ATGCTCAAGACCAATTTCGATAACTACCCGAAAGGAAAAGCTTTCTCGGCGATCCTCGGCGACCTTCTCGGCCGAGGGATTTTCAACGTCGACGGTAAGTGCTGGAGGTTTCAGAGGAAGATGGCGAGTTTGGAACTTGGGAGTGTGTCTATCAGATCGCACGCTTTGAACGTTGTGGTGGATGAGATTGAATCCAGGCTTATTCCGTTCTTTTCATCGGTCGCCGACAACAACGACGGCTCTGTTTTGGACCTGCAAGA...

Protein

Download Protein FASTA

282 aa · TkA01G127600|TK1151|PROTEIN

MLKTNFDNYPKGKAFSAILGDLLGRGIFNVDGKCWRFQRKMASLELGSVSIRSHALNVVVDEIESRLIPFFSSVADNNDGSVLDLQDVFRRFSFDSICKFSFGLDPGSLKPSLPVSELESAFDLSSKLCAERGMAPSPLIWKIKRLYPPVQFDSKFATQDDVFPDGTFVSRGSRVTYHPYAMGRMERIWGPDSMEFKPERWICDGEFKQETAYKYPVYQGGVRVCLGKEMSLVEMKVVALCLIRRFHVRVVNPSQVLRFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G127600`
TK1151 ID	TkA01G127600
OH-1004 ID	LXL04_004662
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.800
Protein coverage (%)	TK1151 100.000 / OH-1004 82.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G127600

Location Chr01:32216283-32217506 (+)

Description Similar to CYP94C1: Cytochrome P450 94C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27690`	Involved in the oxidation of the plant hormone jasmonoyl-L- isoleucine (JA-Ile), a bioactive phytohormone of the jasmonate-mediated signaling pathway.	Characterization of a methyl jasmonate and wounding-responsive cytochrome P450 of Arabidopsis thaliana catalyzing dicarboxylic fatty acid formation in vitro.2007 · DOI: 10.1111/j.1742-4658.2007.06032.x Cytochromes P450 CYP94C1 and CYP94B3 catalyze two successive oxidation steps of plant hormone Jasmonoyl-isoleucine for catabolic turnover.2012 · DOI: 10.1074/jbc.m111.316364 Sequential oxidation of Jasmonoyl-Phenylalanine and Jasmonoyl-Isoleucine by multiple cytochrome P450 of the CYP94 family through newly identified aldehyde intermediates.2015 · DOI: 10.1016/j.phytochem.2015.06.027
`At5g63450`	Hydroxylase involved in the oxidation of the plant hormone jasmonoyl-L-isoleucine (JA-Ile), a bioactive phytohormone of the jasmonate-mediated signaling pathway.	Endoplasmic reticulum-associated inactivation of the hormone jasmonoyl-L-isoleucine by multiple members of the cytochrome P450 94 family in Arabidopsis.2014 · DOI: 10.1074/jbc.m114.603084
`At5g58860`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335 CYP86A1 from Arabidopsis thaliana encodes a cytochrome P450-dependent fatty acid omega-hydroxylase.1998 · DOI: 10.1006/bbrc.1998.8156
`At3g48520`	May hydroxylate jasmonoyl-L-isoleucine in jasmonate signaling.	Cytochrome P450 CYP94B3 mediates catabolism and inactivation of the plant hormone jasmonoyl-L-isoleucine.2011 · DOI: 10.1073/pnas.1103542108 Arabidopsis CYP94B3 encodes jasmonyl-L-isoleucine 12-hydroxylase, a key enzyme in the oxidative catabolism of jasmonate.2011 · DOI: 10.1093/pcp/pcr110 Cytochromes P450 CYP94C1 and CYP94B3 catalyze two successive oxidation steps of plant hormone Jasmonoyl-isoleucine for catabolic turnover.2012 · DOI: 10.1074/jbc.m111.316364

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004662 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006694 steroid biosynthetic process Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0010154 fruit development Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0048480 stigma development Biological Process

GO:0048653 anther development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ag:AAD10204

ath:AT2G27690

ath:AT3G48520

ath:AT5G63450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.832

Rank 1 · TkA01G127600 · TK1151

Cytoplasm0.095

Rank 2 · TkA01G127600 · TK1151

Nucleus0.037

Rank 3 · TkA01G127600 · TK1151

Lysosome / Vacuole0.034

Rank 4 · TkA01G127600 · TK1151

Mitochondrion0.031

Rank 5 · TkA01G127600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p4505-108 aa

PF00067p450145-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G127600	`PF00067`	p450	5	108	9.5e-26	91.3
TkA01G127600	`PF00067`	p450	145	257	9.5e-26	91.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUX1`	Arabidopsis thaliana	sp\|Q9ZUX1\|C94C1_ARATH Cytochrome P450 94C1	45.000%	Swiss-Prot	Medium
`Q9FMV7`	Arabidopsis thaliana	sp\|Q9FMV7\|C94B1_ARATH Cytochrome P450 94B1	32.400%	Swiss-Prot	Medium
`P48422`	Arabidopsis thaliana	sp\|P48422\|C86A1_ARATH Cytochrome P450 86A1	29.000%	Swiss-Prot	Low
`Q9SMP5`	Arabidopsis thaliana	sp\|Q9SMP5\|C94B3_ARATH Cytochrome P450 94B3	51.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card