TkA01G125130 | RubberDandelionOmics

Gene overview

TkA01G125130

Reference: TK1151 Chr: Chr01 Coordinates: 31596623-31598282 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · TkA01G125130|TK1151|cDNA

ATGAAATTCGGCCGGGATTTGGTCACCGGAGTTCAAAGAAACTTCACGTCGTGGAAATCCCTTGATGATCCTGCTGTCGGCGATTTTACTGCGTTTATTGATACCAGAGGGTTCCCTCAGATGGTTCTAACGGGCAGCTCGGAGATAGTTTTCCGGGCAGGTTTTCAAACCCCCACGTCCTGCTCTTCCGGATCTAAACTGCTTCATCATTCTCCATTTCCCTCAAACTTCCCCAACTCCCTCATCTTCGTCTCCTCCAG...

CDS

Download CDS FASTA

864 bp · TkA01G125130|TK1151|CDS

ATGAAATTCGGCCGGGATTTGGTCACCGGAGTTCAAAGAAACTTCACGTCGTGGAAATCCCTTGATGATCCTGCTGTCGGCGATTTTACTGCGTTTATTGATACCAGAGGGTTCCCTCAGATGGTTCTAACGGGCAGCTCGGAGATAGTTTTCCGGGCAGGTTTTCAAACCCCCACGTCCTGCTCTTCCGGATCTAAACTGCTTCATCATTCTCCATTTCCCTCAAACTTCCCCAACTCCCTCATCTTCGTCTCCTCCAG...

Protein

Download Protein FASTA

287 aa · TkA01G125130|TK1151|PROTEIN

MKFGRDLVTGVQRNFTSWKSLDDPAVGDFTAFIDTRGFPQMVLTGSSEIVFRAGFQTPTSCSSGSKLLHHSPFPSNFPNSLIFVSSSSKFAAIPQLQFCLRSPVSRSSSLDSSPLNQLSPVSVDQRVLVLPHAIRLRIKMSQLCILASLNHCTSKLQMGTRPFEDIGSHRTKLLVYNLWLNDEGIYELDFDEDDEAYVSMLYLKKLKNFKIFLRGEPVTQFNIADELKCREVVTYSPQVSSLKAAIVETTLGFIKVAPAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G125130`
TK1151 ID	TkA01G125130
OH-1004 ID	LXL04_034391
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	76.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G125130

Location Chr01:31596623-31598282 (-)

Description Similar to MORC1: Protein MICRORCHIDIA 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36290`	Mediator of defense signaling triggered by distinct classes of R proteins.	MORC family ATPases required for heterochromatin condensation and gene silencing.2012 · DOI: 10.1126/science.1221472 Transcriptional gene silencing by Arabidopsis microrchidia homologues involves the formation of heteromers.2014 · DOI: 10.1073/pnas.1406611111
`At4g36280`	Mediator of defense signaling triggered by distinct classes of R proteins.	Endosome-associated CRT1 functions early in resistance gene-mediated defense signaling in Arabidopsis and tobacco.2010 · DOI: 10.1105/tpc.109.071662 CRT1 is a nuclear-translocated MORC endonuclease that participates in multiple levels of plant immunity.2012 · DOI: 10.1038/ncomms2279 Transcriptional gene silencing by Arabidopsis microrchidia homologues involves the formation of heteromers.2014 · DOI: 10.1073/pnas.1406611111
`At4g36270`	Exhibits ATPase activity.	No verified direct reference in this release
`At5g50780`	Exhibits ATPase activity.	Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998
`At5g13130`	Exhibits ATPase activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034391 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002230 positive regulation of defense response to virus by host Biological Process

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0051607 defense response to virus Biological Process

GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0098542 defense response to other organism Biological Process

KEGG gene cross-reference

ath:AT1G19100

ath:AT4G36270

ath:AT4G36280

ath:AT4G36290

ath:AT5G50780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.323

Rank 1 · TkA01G125130 · TK1151

Cytoplasm0.305

Rank 2 · TkA01G125130 · TK1151

Endoplasmic reticulum0.195

Rank 3 · TkA01G125130 · TK1151

Cell membrane0.172

Rank 4 · TkA01G125130 · TK1151

Mitochondrion0.098

Rank 5 · TkA01G125130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17589DUF5487180-203 aa

PF17942Morc6_S5196-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G125130	`PF17589`	DUF5487	180	203	0.17	12.7
TkA01G125130	`PF17942`	Morc6_S5	196	275	2.3e-25	90.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WV6`	Arabidopsis thaliana	sp\|Q84WV6\|MORC1_ARATH Protein MICRORCHIDIA 1	50.700%	Swiss-Prot	Low
`Q5FV35`	Arabidopsis thaliana	sp\|Q5FV35\|MORC2_ARATH Protein MICRORCHIDIA 2	48.000%	Swiss-Prot	Low
`F4JPP0`	Arabidopsis thaliana	sp\|F4JPP0\|MORC3_ARATH Protein MICRORCHIDIA 3	49.000%	Swiss-Prot	Low
`F4KAF2`	Arabidopsis thaliana	sp\|F4KAF2\|MORC4_ARATH Protein MICRORCHIDIA 4	34.900%	Swiss-Prot	Low
`F4K2G3`	Arabidopsis thaliana	sp\|F4K2G3\|MORC5_ARATH Protein MICRORCHIDIA 5	34.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card