TkA01G122850 | RubberDandelionOmics

Gene overview

TkA01G122850

Reference: TK1151 Chr: Chr01 Coordinates: 31117687-31119808 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1797 bp · TkA01G122850|TK1151|cDNA

ATGCTTACAAAAAGATTTTCAGACTTAAATAAAATACACCAAAGTAACCCCAAACCTACTATTAGAAATTATTGGTCCAGACCTTCCCTTCCTGATATTCAAATTGAAGAAAGACCATTCTTGTATGATAGATCCGCCTATGATGGTACCTCTGTCTACGAATGGAACATAGATGGTTATTCTGAACACCAGATTTTAAACATTGTTACTGAAATCAATATGGCAGCTAATGCTTATAAGTCAAAAGGCAATACGGAGAT...

CDS

Download CDS FASTA

1797 bp · TkA01G122850|TK1151|CDS

ATGCTTACAAAAAGATTTTCAGACTTAAATAAAATACACCAAAGTAACCCCAAACCTACTATTAGAAATTATTGGTCCAGACCTTCCCTTCCTGATATTCAAATTGAAGAAAGACCATTCTTGTATGATAGATCCGCCTATGATGGTACCTCTGTCTACGAATGGAACATAGATGGTTATTCTGAACACCAGATTTTAAACATTGTTACTGAAATCAATATGGCAGCTAATGCTTATAAGTCAAAAGGCAATACGGAGAT...

Protein

Download Protein FASTA

598 aa · TkA01G122850|TK1151|PROTEIN

MLTKRFSDLNKIHQSNPKPTIRNYWSRPSLPDIQIEERPFLYDRSAYDGTSVYEWNIDGYSEHQILNIVTEINMAANAYKSKGNTEIQIVNIIISGFTGTLKGWWDFYVTPDEKLGILNAKKTVIKTEDGLQTAETQQDDMVNTLIFAIIKNFVGDPTMFQEKTSEILMNLYCRKLTDFRWYRENYLLKVFTRPDCKESYWKERFIAGLPKIFADRVREKLRSDYKNDIPYKTLTYGDLTSYINNEGLAVCSDLRLKQKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G122850`
TK1151 ID	TkA01G122850
OH-1004 ID	LXL04_039814
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 38.796 / OH-1004 99.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G122850`
Location	Chr01:31117687-31119808 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039814` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.523

Rank 1 · TkA01G122850 · TK1151

Cytoplasm0.430

Rank 2 · TkA01G122850 · TK1151

Mitochondrion0.064

Rank 3 · TkA01G122850 · TK1151

Cell membrane0.044

Rank 4 · TkA01G122850 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA01G122850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24925DUF774647-128 aa

PF28884Gen_polyprot_petuvir83-119 aa

PF00077RVP116-147 aa

PF22909Caulimovir_coat_dom160-265 aa

PF28884Gen_polyprot_petuvir162-174 aa

PF04799Fzo_mitofusin258-278 aa

PF22909Caulimovir_coat_dom288-335 aa

PF24925DUF7746352-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G122850	`PF24925`	DUF7746	47	128	9.9e-30	103.2
TkA01G122850	`PF28884`	Gen_polyprot_petuvir	83	119	0.2	12.6
TkA01G122850	`PF00077`	RVP	116	147	3.2e-09	37.7
TkA01G122850	`PF22909`	Caulimovir_coat_dom	160	265	4.2e-11	43.9
TkA01G122850	`PF28884`	Gen_polyprot_petuvir	162	174	0.2	12.6
TkA01G122850	`PF04799`	Fzo_mitofusin	258	278	0.83	9.8
TkA01G122850	`PF22909`	Caulimovir_coat_dom	288	335	4.2e-11	43.9
TkA01G122850	`PF24925`	DUF7746	352	369	9.9e-30	103.2
TkA01G122850	`PF23159`	WHD_Rok	352	366	6.3	7.6
TkA01G122850	`PF04799`	Fzo_mitofusin	390	428	0.83	9.8
TkA01G122850	`PF23159`	WHD_Rok	401	433	6.3	7.6
TkA01G122850	`PF28884`	Gen_polyprot_petuvir	450	477	0.2	12.6
TkA01G122850	`PF24925`	DUF7746	451	478	9.9e-30	103.2
TkA01G122850	`PF00077`	RVP	484	567	3.2e-09	37.7
TkA01G122850	`PF30863`	PRO_PEG10-RTL1	488	569	0.012	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card