RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G122430
Reference: TK1151 Chr: Chr01 Coordinates: 31022624-31023043 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

420 bp · TkA01G122430|TK1151|cDNA

ATGAAAATCAAGTCATTTCACAAGGATTGGAGATGGATTTTATTGAGTTGTGTGTGCGTATTGAGGCCAAACACTGAAAAAGAAGGCAATTGCTATGTTGACGAAGACCAAAAAGAGGAACTAGATATCACCTACATCTATGTTGAAGAAGAATTATACGACTTCGAAAATAGACCACCCCTAAATTGCATTGACTTGTTCCTTAACACTCTTTGTGGAGACTCTAATGCTTATATACATGGGGTCGAAGGTAGTGATGA...

CDS

Download CDS FASTA

420 bp · TkA01G122430|TK1151|CDS

ATGAAAATCAAGTCATTTCACAAGGATTGGAGATGGATTTTATTGAGTTGTGTGTGCGTATTGAGGCCAAACACTGAAAAAGAAGGCAATTGCTATGTTGACGAAGACCAAAAAGAGGAACTAGATATCACCTACATCTATGTTGAAGAAGAATTATACGACTTCGAAAATAGACCACCCCTAAATTGCATTGACTTGTTCCTTAACACTCTTTGTGGAGACTCTAATGCTTATATACATGGGGTCGAAGGTAGTGATGA...

Protein

Download Protein FASTA

139 aa · TkA01G122430|TK1151|PROTEIN

MKIKSFHKDWRWILLSCVCVLRPNTEKEGNCYVDEDQKEELDITYIYVEEELYDFENRPPLNCIDLFLNTLCGDSNAYIHGVEGSDDEEYGYDIEANTIEINYYLMMKMDLVLNFAPMIPLFSGRKMKPLRKEMYESLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G122430
TK1151 IDTkA01G122430
OH-1004 IDLXL04_004689
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)85.500
Protein coverage (%)TK1151 99.281 / OH-1004 91.391
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G122430
LocationChr01:31022624-31023043 (-)
DescriptionSimilar to ARF16: Auxin response factor 16
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004689 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007389 pattern specification process Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009743 response to carbohydrate Biological Process
GO:0010154 fruit development Biological Process
GO:0031540 regulation of anthocyanin biosynthetic process Biological Process
GO:0048366 leaf development Biological Process
GO:0048441 petal development Biological Process
GO:0048442 sepal development Biological Process
KEGG gene cross-reference
ath:AT2G28350
ath:AT4G30080
dosa:Os04g0519700
dosa:Os06g0685700
dosa:Os10g0479900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.474
Rank 1 · TkA01G122430 · TK1151
Cytoplasm0.382
Rank 2 · TkA01G122430 · TK1151
Mitochondrion0.116
Rank 3 · TkA01G122430 · TK1151
Cell membrane0.094
Rank 4 · TkA01G122430 · TK1151
Endoplasmic reticulum0.081
Rank 5 · TkA01G122430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser