TkA01G119880 | RubberDandelionOmics

Gene overview

TkA01G119880

Reference: TK1151 Chr: Chr01 Coordinates: 30379702-30380115 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA01G119880|TK1151|cDNA

ATGGTGGAGTTCCCGGCTCTAAATGGCCAAAGCGTTTCACTTTCAGTCCTCCGGTTAGCACCTGGAGGAGTGAGTCCACCGCACACGAGACCCCATGCAACCGGGATTTTTTTGGTGTTGGAGGGTCAGTTCGAGGTTGGTTTTGTGGATACGACCAATAGGCTTTACACTCAAACGTTACAAACGGGAGACATGTTCATATTTCCAAAGGGACTTGTTCATTACCAGTATAATCCTGATATGAAGAAGCCGGCCATGGC...

CDS

Download CDS FASTA

414 bp · TkA01G119880|TK1151|CDS

ATGGTGGAGTTCCCGGCTCTAAATGGCCAAAGCGTTTCACTTTCAGTCCTCCGGTTAGCACCTGGAGGAGTGAGTCCACCGCACACGAGACCCCATGCAACCGGGATTTTTTTGGTGTTGGAGGGTCAGTTCGAGGTTGGTTTTGTGGATACGACCAATAGGCTTTACACTCAAACGTTACAAACGGGAGACATGTTCATATTTCCAAAGGGACTTGTTCATTACCAGTATAATCCTGATATGAAGAAGCCGGCCATGGC...

Protein

Download Protein FASTA

137 aa · TkA01G119880|TK1151|PROTEIN

MVEFPALNGQSVSLSVLRLAPGGVSPPHTRPHATGIFLVLEGQFEVGFVDTTNRLYTQTLQTGDMFIFPKGLVHYQYNPDMKKPAMAVAVFGSASSAVVSVPSNLFKSNIDDVVLAKSFKTDVATIQKLRTCLGGKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G119880`
TK1151 ID	TkA01G119880
OH-1004 ID	LXL04_004708
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 67.822 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G119880

Location Chr01:30379702-30380115 (-)

Description Similar to Os09g0568700: Germin-like protein 9-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0568700`	May play a role in plant defense.	No verified direct reference in this release
`Os09g0568600`	May play a role in plant defense.	No verified direct reference in this release
`Os09g0568500`	May play a role in plant defense.	No verified direct reference in this release
`Os08g0189100`	Plays a role in broad-spectrum disease resistance.	No verified direct reference in this release
`Os08g0188900`	Plays a role in broad-spectrum disease resistance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004708 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0030145 manganese ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G02335

ath:AT3G62020

dosa:Os09g0568500

dosa:Os09g0568700

osa:107277596

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.959

Rank 1 · TkA01G119880 · TK1151

Cytoplasm0.021

Rank 2 · TkA01G119880 · TK1151

Cell membrane0.012

Rank 3 · TkA01G119880 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA01G119880 · TK1151

Lysosome / Vacuole0.008

Rank 5 · TkA01G119880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_13-126 aa

PF12973Cupin_715-46 aa

PF07883Cupin_216-91 aa

PF02311AraC_binding24-75 aa

PF14801TrmI-like_N46-75 aa

PF08007JmjC_251-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G119880	`PF00190`	Cupin_1	3	126	2.5e-32	112.3
TkA01G119880	`PF12973`	Cupin_7	15	46	0.23	12.0
TkA01G119880	`PF07883`	Cupin_2	16	91	3.1e-12	46.7
TkA01G119880	`PF02311`	AraC_binding	24	75	0.13	12.8
TkA01G119880	`PF14801`	TrmI-like_N	46	75	0.16	12.6
TkA01G119880	`PF08007`	JmjC_2	51	90	0.033	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q652P9`	Oryza sativa subsp. japonica	sp\|Q652P9\|GL93_ORYSJ Germin-like protein 9-3	60.200%	Swiss-Prot	High
`Q652Q0`	Oryza sativa subsp. japonica	sp\|Q652Q0\|GL92_ORYSJ Putative germin-like protein 9-2	58.600%	Swiss-Prot	High
`Q652Q1`	Oryza sativa subsp. japonica	sp\|Q652Q1\|GL91_ORYSJ Germin-like protein 9-1	50.000%	Swiss-Prot	High
`Q6YZA9`	Oryza sativa subsp. japonica	sp\|Q6YZA9\|GL82_ORYSJ Germin-like protein 8-2	43.300%	Swiss-Prot	Medium
`Q6YZB2`	Oryza sativa subsp. japonica	sp\|Q6YZB2\|GL81_ORYSJ Putative germin-like protein 8-1	42.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card