TkA01G117350 | RubberDandelionOmics

Gene overview

TkA01G117350

Reference: TK1151 Chr: Chr01 Coordinates: 29723081-29725264 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1448 bp · TkA01G117350|TK1151|cDNA

AAAGGACAAAACGACGTCGTTTTGATTGATACTGTTCACAAGAGGCAACGGCATTTAATCTGGAGAGTAGTATATTCCATTTCAGTGCCGGTCGACCTAACCGACTTGGTCTCAGTTAGGACTTAGGAGTCTGGGTCCGTCAATCCCGTCCCAAACCAAATGTTGCCGATACTTCGTTCCAGACAGTTAGCACAGCGGTGTTTGACACAAAACAAGCGACTTTTGACTCCCTACTCCTTCGCCACCGACCGCCATGGCTC...

CDS

Download CDS FASTA

978 bp · TkA01G117350|TK1151|CDS

ATGTTGCCGATACTTCGTTCCAGACAGTTAGCACAGCGGTGTTTGACACAAAACAAGCGACTTTTGACTCCCTACTCCTTCGCCACCGACCGCCATGGCTCGATGCTCAATCGAGCATCACCGCCACCGATCCAGGTACTCCTCACTGAATCAGCTGGACGTGGTGTTTTTGCTACGCGGAAAATAGAATCTGGCGAACTCATCCATACTGCCAAACCCGTCGTCTCTCACCCACTTCTCTCCTCAATTGACAAAGTATG...

Protein

Download Protein FASTA

325 aa · TkA01G117350|TK1151|PROTEIN

MLPILRSRQLAQRCLTQNKRLLTPYSFATDRHGSMLNRASPPPIQVLLTESAGRGVFATRKIESGELIHTAKPVVSHPLLSSIDKVCYYCLKNTPKGSNFEAQKVLFCSEECREQAKGFYEVEKEADWSAFIAHCRTRSLKYPFLAKRLACMVISGVTSADSLNVLQPALLSPQIISQMEEELDLLRCALEGSGMKTEHLSFLTIEWYTGVLSRIRINAFRIELAGGSSYEDLLTSAYASVESEASVGNAVYMLPSFYNH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G117350`
TK1151 ID	TkA01G117350
OH-1004 ID	LXL04_004736
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G117350

Location Chr01:29723081-29725264 (+)

Description Similar to ATXR4: Histone-lysine N-methyltransferase ATXR4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06620`	Histone methyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004736 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000993 RNA polymerase II complex binding Molecular Function

GO:0001162 RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016279 protein-lysine N-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G06620

ddi:DDB_G0292140

ddi:DDB_G0292454

hsa:64754

pic:PICST_63965

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.663

Rank 1 · TkA01G117350 · TK1151

Plastid0.143

Rank 2 · TkA01G117350 · TK1151

Cytoplasm0.143

Rank 3 · TkA01G117350 · TK1151

Nucleus0.101

Rank 4 · TkA01G117350 · TK1151

Peroxisome0.052

Rank 5 · TkA01G117350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00856SET53-294 aa

PF04570zf-FLZ87-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G117350	`PF00856`	SET	53	294	2.2e-15	57.7
TkA01G117350	`PF04570`	zf-FLZ	87	115	0.92	9.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG08`	Arabidopsis thaliana	sp\|Q9FG08\|ATXR4_ARATH Histone-lysine N-methyltransferase ATXR4	58.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card