TkA01G112960 | RubberDandelionOmics

Gene overview

TkA01G112960

Reference: TK1151 Chr: Chr01 Coordinates: 28676836-28684875 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

875 bp · TkA01G112960|TK1151|cDNA

CTAAACCCCCTGAATTTTACTTCAGTCCATTTCTAGTTTATCAACTTCACCGGAAAATCAAACACCGCCGGTGTGAGGGGCTCACTCAGGCGGAGGAAACAAGCACATGCGAATAATTAGTTAAACTGAATTAGATAAATTTTTACTCGATTACGGCAGTCATTCATTTTCCTCGCTGTTAGTGGATCAAATTTAAGATCGACACTTTGATCTTATGCAAGCATTGCATCTAACAGCTAACGCGGCTTCGTGTGCATCGA...

CDS

Download CDS FASTA

546 bp · TkA01G112960|TK1151|CDS

ATGGAAGGTTTCAGGGGTAGATTTAGATTAGCAGCAATCGTTATTATTTCCATTGGGATTGGCTTACTTGCCATTTATGATTTATTGAAGCCAATTAAAAATGGTTGCAACACGACATACATGTACCAAACTTACATTCCAATATCACCTCCAAAAAGTTTATCTTCTTCAAAATATGGACTCTATTTATATCACGAAGGCTGGAAAAAAATCGATTTCAATGAGCATCTCAAACAACTCAATGGAGTTCCCATTCTTTT...

Protein

Download Protein FASTA

181 aa · TkA01G112960|TK1151|PROTEIN

MEGFRGRFRLAAIVIISIGIGLLAIYDLLKPIKNGCNTTYMYQTYIPISPPKSLSSSKYGLYLYHEGWKKIDFNEHLKQLNGVPILFIPGNGGSYKQVRSMAAESDRAYQGGPPEPILYQEAGVEIDETDIPKVNRYSRRLDWFAVDLEGEHSAMDGQILEEHTEYVVYAIHRVSFNFIIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G112960`
TK1151 ID	TkA01G112960
OH-1004 ID	LXL04_002119
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.300
Protein coverage (%)	TK1151 96.133 / OH-1004 16.747 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G112960`
Location	Chr01:28676836-28684875 (-)
Description	Similar to BST1: GPI inositol-deacylase (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002119` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006505 GPI anchor metabolic process Biological Process GO:0006506 GPI anchor biosynthetic process Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0015031 protein transport Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016788 hydrolase activity, acting on ester bonds Molecular Function GO:0050185 phosphatidylinositol deacylase activity Molecular Function GO:0160215 deacylase activity Molecular Function
KEGG gene cross-reference	afm:AFUA_7G05540 ncr:NCU08021 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.425

Rank 1 · TkA01G112960 · TK1151

Endoplasmic reticulum0.249

Rank 2 · TkA01G112960 · TK1151

Lysosome / Vacuole0.172

Rank 3 · TkA01G112960 · TK1151

Cytoplasm0.121

Rank 4 · TkA01G112960 · TK1151

Extracellular0.084

Rank 5 · TkA01G112960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07819PGAP179-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G112960	`PF07819`	PGAP1	79	174	1.9e-24	87.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card