TkA01G111870 | RubberDandelionOmics

Gene overview

TkA01G111870

Reference: TK1151 Chr: Chr01 Coordinates: 28432153-28434726 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1246 bp · TkA01G111870|TK1151|cDNA

CCTTCCCCAATCTTGACCTATGTCGTCGACTGCGTTTCGATTATCCTCAACACTGCTCTTATTCCCCGACTCCGAGCTGCTCTAAAACGCTGCTGAGTGTTTCTGTTATGCAATAATCACAAGCTCAGCTCTAGCTGTTTGGGGGGATTTTTTATCAGGTCGTTCAGCTGAATGACGATGATGGGTTGTTGCGTTCCCTCTCGTGACACATCGAATCGTTTCTCCGACCGATGCTTCAATGTCTTCCCCTGTCTATCCGA...

CDS

Download CDS FASTA

459 bp · TkA01G111870|TK1151|CDS

ATGAGAGAATATGCCAGGACAGAAGCATCATTGAGGGCATCAAAAATCTCAAAACAGCCTGCTTCAAGCAAAAATGGCAGTGTAGTTGTGACCATAGACAGCAACCAATTTGGAGAACATCTTTTAGGGAATAACCTTTTGAATTGGACAAAGATAGTCATGGACATGTACCCTCCTGGAACATCTGTCAGGACTTACACCTGCTCATACTGTAATGTTGTGCAGCCTCCAAGAGCAAAGCATTGCCATGATTGTGACAG...

Protein

Download Protein FASTA

152 aa · TkA01G111870|TK1151|PROTEIN

MREYARTEASLRASKISKQPASSKNGSVVVTIDSNQFGEHLLGNNLLNWTKIVMDMYPPGTSVRTYTCSYCNVVQPPRAKHCHDCDRCVLQFDHYCVWLGTSIGQGNHCRFWWYILGETALSIWTGILYIKYLQTHIEKVPSNMLIKNYLFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G111870`
TK1151 ID	TkA01G111870
OH-1004 ID	LXL04_004796
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 64.681 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G111870

Location Chr01:28432153-28434726 (-)

Description Similar to PAT10: Protein S-acyltransferase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51390`	S-acyltransferase involved in protein lipid modification.	Protein S-ACYL Transferase10 is critical for development and salt tolerance in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108829

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004796 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006869 lipid transport Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009651 response to salt stress Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0032495 response to muramyl dipeptide Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0051604 protein maturation Biological Process

GO:0062208 positive regulation of pattern recognition receptor signaling pathway Biological Process

KEGG gene cross-reference

ath:AT3G51390

hsa:25921

mmu:228136

pon:100173176

ptr:451199

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.339

Rank 1 · TkA01G111870 · TK1151

Golgi apparatus0.233

Rank 2 · TkA01G111870 · TK1151

Cytoplasm0.229

Rank 3 · TkA01G111870 · TK1151

Cell membrane0.186

Rank 4 · TkA01G111870 · TK1151

Lysosome / Vacuole0.165

Rank 5 · TkA01G111870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01529DHHC65-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G111870	`PF01529`	DHHC	65	139	2.1e-22	80.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XA86`	Arabidopsis thaliana	sp\|Q7XA86\|ZDH11_ARATH Protein S-acyltransferase 10	55.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card