TkA01G110390 | RubberDandelionOmics

Gene overview

TkA01G110390

Reference: TK1151 Chr: Chr01 Coordinates: 28051057-28058580 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1692 bp · TkA01G110390|TK1151|cDNA

ATGCTCTCCCCCATGTTTAAGGGAGACACGAGTCCGATTGTTAGTATGCGCTGGATATCTGATGTGCAGGGTGCGTTTTTCACTTGTGGTTGCCCAGACCACCTACGAGTCCGTTATGCTAGTAATCTACTGCGCGAAGGAGCCCGAGACTTGTGGGCCACGTGGACTGTGGATATGGCGCCCACCGAGGTCGCTTCTATTACTTGGGAGGAGTTTGTGATTCGATTCAAGGCGGGAGAGTATAAAAGAGGTGTGTGGAT...

CDS

Download CDS FASTA

1692 bp · TkA01G110390|TK1151|CDS

ATGCTCTCCCCCATGTTTAAGGGAGACACGAGTCCGATTGTTAGTATGCGCTGGATATCTGATGTGCAGGGTGCGTTTTTCACTTGTGGTTGCCCAGACCACCTACGAGTCCGTTATGCTAGTAATCTACTGCGCGAAGGAGCCCGAGACTTGTGGGCCACGTGGACTGTGGATATGGCGCCCACCGAGGTCGCTTCTATTACTTGGGAGGAGTTTGTGATTCGATTCAAGGCGGGAGAGTATAAAAGAGGTGTGTGGAT...

Protein

Download Protein FASTA

563 aa · TkA01G110390|TK1151|PROTEIN

MLSPMFKGDTSPIVSMRWISDVQGAFFTCGCPDHLRVRYASNLLREGARDLWATWTVDMAPTEVASITWEEFVIRFKAGEYKRGVWILVGFLNLLVAFSRCGFRFLNAPTGRRMDVSTTKAEFRRQFSPFGKVTDIYFGVKKGRNSNNFGFVQYEGVADAQQLEQRLSGIKCRNNSLEVNIEKHQRKTLQQRRMAPNLNHREAMGRPENGSSGAGFRDKRSYANVTGRKHDGENTEGQQPPQAEIRVDSIPLAADDSMTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G110390`
TK1151 ID	TkA01G110390
OH-1004 ID	LXL04_004789
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.600
Protein coverage (%)	TK1151 59.503 / OH-1004 76.768 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G110390`
Location	Chr01:28051057-28058580 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004789` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.419

Rank 1 · TkA01G110390 · TK1151

Nucleus0.335

Rank 2 · TkA01G110390 · TK1151

Cell membrane0.124

Rank 3 · TkA01G110390 · TK1151

Mitochondrion0.088

Rank 4 · TkA01G110390 · TK1151

Plastid0.058

Rank 5 · TkA01G110390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03732PEG10_N-capsid4-78 aa

PF00076RRM_1117-177 aa

PF14605Nup35_RRM_2122-162 aa

PF01665Rota_NSP3151-199 aa

PF12548DUF3740183-193 aa

PF00076RRM_1302-317 aa

PF01665Rota_NSP3345-385 aa

PF00076RRM_1361-378 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G110390	`PF03732`	PEG10_N-capsid	4	78	1.7e-05	25.8
TkA01G110390	`PF00076`	RRM_1	117	177	5.6e-09	36.5
TkA01G110390	`PF14605`	Nup35_RRM_2	122	162	0.041	14.5
TkA01G110390	`PF01665`	Rota_NSP3	151	199	0.035	13.9
TkA01G110390	`PF12548`	DUF3740	183	193	0.19	12.8
TkA01G110390	`PF00076`	RRM_1	302	317	5.6e-09	36.5
TkA01G110390	`PF01665`	Rota_NSP3	345	385	0.035	13.9
TkA01G110390	`PF00076`	RRM_1	361	378	5.6e-09	36.5
TkA01G110390	`PF12548`	DUF3740	394	461	0.19	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card