Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1510 bp · TkA01G101190|TK1151|cDNA
GTAAAGTTGTACTTACATCTCTCCACTCCTCCAACTCTGTAACGCTATCTTCCCTCTGTGTCCCTTTCTCTCGTTATCATCTCAAAGCTTTGATTTTTCTTCTCCACAACTCTCTGATATTCTCCCGTTTACCATCTGCGAAAAGCCTAATTTTGATATTTATTTCCAACGAAGTTCTCACTTCTCAGTGTTCCTGATCACAATATTTGGAACATTTTTCCATTCCCATGGAGGTTCCAGAAATTGAAGAAGGTGAAAAG...
951 bp · TkA01G101190|TK1151|CDS
ATGGAGGTTCCAGAAATTGAAGAAGGTGAAAAGGGAAGTCATCTAATTTCGCCTGCAGCTTTTGTGGAAGGAGGGATACAAGAAGCCTGTGAAGACTCTTGTAGCATTTGCCTCGAGGCTTTCTGTGATAGTGATCCAGGAACTGTGACGAGTTGCAAGCATGAATTCCACCTGCAATGTATACTCGAATGGTGTCAAAGAAGCTCTAATTGTCCTATGTGTTGGCAAGCCATTAGCCTTAAGGATCCATCTAGTCAAGA...
Protein
Download Protein FASTA316 aa · TkA01G101190|TK1151|PROTEIN
MEVPEIEEGEKGSHLISPAAFVEGGIQEACEDSCSICLEAFCDSDPGTVTSCKHEFHLQCILEWCQRSSNCPMCWQAISLKDPSSQELLEGVEQERRVRFINPTRNPTIFHHPTLGDFELQHLPVGVNDSELEERIIQHLAAAAAMGRARHLGRREGSRTRSTPHGRPQFLVFSTSPNAGPVAGSGGPVVQQSGEVGGEGGPAVITQQGPSVIHRNSGSISPLPDQFTAGPSELQTSSDTWKSKFNAISTRYKESLSKST...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G101190 |
|---|---|
| TK1151 ID | TkA01G101190 |
| OH-1004 ID | LXL04_004854 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 98.500 |
| Protein coverage (%) | TK1151 60.443 / OH-1004 66.897Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G101190 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:25604263-25606743 (+) | |||||||||
| Description | Similar to RHF2A: E3 ubiquitin-protein ligase RHF2A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009414 response to water deprivation Biological Process GO:0009561 megagametogenesis Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0010498 proteasomal protein catabolic process Biological Process GO:0010729 positive regulation of hydrogen peroxide biosynthetic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0055046 microgametogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G02290 ath:AT4G00335 ath:AT4G14220 ath:AT4G23450 ath:AT5G22000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12678zf-rbx128-74 aaPF11789zf-Nse28-74 aaPF29452FAR1_N31-92 aaPF13639zf-RING_232-74 aaPF17123zf-RING_1134-61 aaPF13923zf-C3HC4_234-74 aaPF00097zf-C3HC434-74 aaPF13445zf-RING_UBOX34-72 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G101190 | PF12678 | zf-rbx1 | 28 | 74 | 1.6e-06 | 28.9 |
| TkA01G101190 | PF11789 | zf-Nse | 28 | 74 | 0.49 | 11.0 |
| TkA01G101190 | PF29452 | FAR1_N | 31 | 92 | 0.66 | 10.7 |
| TkA01G101190 | PF13639 | zf-RING_2 | 32 | 74 | 1.5e-09 | 38.7 |
| TkA01G101190 | PF17123 | zf-RING_11 | 34 | 61 | 2.3e-07 | 31.1 |
| TkA01G101190 | PF13923 | zf-C3HC4_2 | 34 | 74 | 2.9e-06 | 27.7 |
| TkA01G101190 | PF00097 | zf-C3HC4 | 34 | 74 | 3.8e-06 | 27.4 |
| TkA01G101190 | PF13445 | zf-RING_UBOX | 34 | 72 | 3.7e-05 | 24.3 |
| TkA01G101190 | PF14634 | zf-RING_5 | 34 | 74 | 0.0015 | 19.2 |
| TkA01G101190 | PF24921 | RING_XB3-XBAT31 | 34 | 71 | 0.0024 | 18.6 |
| TkA01G101190 | PF23555 | zf-RING_Vps41 | 34 | 68 | 2.5 | 8.5 |
| TkA01G101190 | PF15227 | zf-C3HC4_4 | 34 | 74 | 4.3 | 8.2 |
| TkA01G101190 | PF12861 | zf-ANAPC11 | 42 | 81 | 0.00025 | 21.8 |
| TkA01G101190 | PF17123 | zf-RING_11 | 70 | 79 | 2.3e-07 | 31.1 |
| TkA01G101190 | PF23555 | zf-RING_Vps41 | 71 | 82 | 2.5 | 8.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.