Gene Card
Gene overview
cDNA / CDS / Protein Sequences
962 bp · TkA01G099290|TK1151|cDNA
ATTTGATTGATTTTCTGATTCTAATCCGATTCAAATATGATCAAGATCCGAGAAAATGGCGTGTATGTGCCCGAAACATATCTTCGTGCGAATTTTTGTTGAAACCAGTTTCGAATTTCTCCTCCCTGCACTTTCTACGTTCGTTTTTTCTCGCCTTTTATGGCCGTGGAAGGAGGTGGAACGCTATCGGAACTGTATCAGAGTTCAAGGCGGTTGTTGTTGAAAACTAGAGATGGATTGGAACGCCTTGAGCGTCTTGA...
681 bp · TkA01G099290|TK1151|CDS
ATGGCCGTGGAAGGAGGTGGAACGCTATCGGAACTGTATCAGAGTTCAAGGCGGTTGTTGTTGAAAACTAGAGATGGATTGGAACGCCTTGAGCGTCTTGAATTCTCGTCTTCGGCTGGCACCGTCGATTCTCCGGAGCTTGCAGTTGCCGTCCGAAAAGATATCTCTCAAATTCAAACCCTTTGTTCCGATATGGACGGACTCTGGCGATCCGTTGCTTCCAAACCCCAGCGCGATCTCTGGAAAAGAAAAGTGGAGCA...
Protein
Download Protein FASTA226 aa · TkA01G099290|TK1151|PROTEIN
MAVEGGGTLSELYQSSRRLLLKTRDGLERLERLEFSSSAGTVDSPELAVAVRKDISQIQTLCSDMDGLWRSVASKPQRDLWKRKVEQISEEADSFRESLDRYFQRKQKRIQEAQERAELLGRANGESSHVLRIFDEEAQAMQSARNSSRMLEEATATGTAILAKYSEQRDRLKRAQRKALDVLNTLGLSNTVLRVIERRNRVDQRIKYAGMILTFVIVIAFLRWTR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G099290 |
|---|---|
| TK1151 ID | TkA01G099290 |
| OH-1004 ID | LXL04_004887 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G099290 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:25128793-25130192 (-) | |||||||||
| Description | Similar to MEMB11: Membrin-11 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006891 intra-Golgi vesicle-mediated transport Biological Process GO:0006906 vesicle fusion Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0045088 regulation of innate immune response Biological Process GO:0050708 regulation of protein secretion Biological Process GO:0000138 Golgi trans cisterna Cellular Component GO:0000139 Golgi membrane Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005801 cis-Golgi network Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G36900 ath:AT5G50440 cbr:CBG_16136 mmu:56494 rno:64154 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27021BOS1_GOSR2_MEM11-like_N9-122 aaPF03908Sec209-32 aaPF00831Ribosomal_L2927-61 aaPF12352V-SNARE_C36-54 aaPF24531ANC1_spectrin46-101 aaPF29890DUF860147-113 aaPF11896GlgE_dom_N_S69-181 aaPF00831Ribosomal_L2979-100 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G099290 | PF27021 | BOS1_GOSR2_MEM11-like_N | 9 | 122 | 6.2e-34 | 117.3 |
| TkA01G099290 | PF03908 | Sec20 | 9 | 32 | 4.2e-05 | 24.1 |
| TkA01G099290 | PF00831 | Ribosomal_L29 | 27 | 61 | 0.0095 | 16.6 |
| TkA01G099290 | PF12352 | V-SNARE_C | 36 | 54 | 2.2e-16 | 60.6 |
| TkA01G099290 | PF24531 | ANC1_spectrin | 46 | 101 | 0.008 | 17.3 |
| TkA01G099290 | PF29890 | DUF8601 | 47 | 113 | 0.069 | 14.2 |
| TkA01G099290 | PF11896 | GlgE_dom_N_S | 69 | 181 | 0.023 | 15.7 |
| TkA01G099290 | PF00831 | Ribosomal_L29 | 79 | 100 | 0.0095 | 16.6 |
| TkA01G099290 | PF04293 | SpoVR | 82 | 183 | 0.041 | 13.3 |
| TkA01G099290 | PF03908 | Sec20 | 87 | 117 | 4.2e-05 | 24.1 |
| TkA01G099290 | PF15346 | ARGLU | 87 | 173 | 0.13 | 12.8 |
| TkA01G099290 | PF12352 | V-SNARE_C | 108 | 131 | 2.2e-16 | 60.6 |
| TkA01G099290 | PF25417 | DUF7889 | 119 | 138 | 0.0047 | 16.8 |
| TkA01G099290 | PF12352 | V-SNARE_C | 135 | 200 | 2.2e-16 | 60.6 |
| TkA01G099290 | PF03908 | Sec20 | 139 | 224 | 4.2e-05 | 24.1 |
| TkA01G099290 | PF24531 | ANC1_spectrin | 142 | 176 | 0.008 | 17.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.