TkA01G096310 | RubberDandelionOmics

Gene overview

TkA01G096310

Reference: TK1151 Chr: Chr01 Coordinates: 24338221-24340463 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

845 bp · TkA01G096310|TK1151|cDNA

TTTCAAAAATTTCAAGAACTTTATATAAGAAACAGAAGACGATAATCACCGTCATCGGCTTGCCTTTCCGGTCGCGACAACGGAACCCTAGTCCTGTCTGATTGATTTGGCGATCGACGGCCGCTCCACCGGTGCTCGCTGTTAACCACTCTACTGATTCTTCTTACTTCGGACTTCTTTTCCCCGAGTGCAAAAAAGAGCAATAAGAAACATGAACCACAACCAGCAATCAAACGAAGCTAAACACAATGATGAAACTG...

CDS

Download CDS FASTA

411 bp · TkA01G096310|TK1151|CDS

ATGAACCACAACCAGCAATCAAACGAAGCTAAACACAATGATGAAACTGCCCTCACAGATTTTCTTGCCTCATTAACAGACTACACCCCAACGATTCCTGATGAACTGGTGGAACATTACTTAGCCAAAAGTGGGTTTCAATGTCCAGATGTTCGATTAATAAGACTAGTTGCAGTTGCCACTCAGAAGTTTGTCTCAGAGGTTGCCACTGAAGCTCTCCAGCAATGCAAGGCGAGACCAGCACCCGTGGTCAGGGACAA...

Protein

Download Protein FASTA

136 aa · TkA01G096310|TK1151|PROTEIN

MNHNQQSNEAKHNDETALTDFLASLTDYTPTIPDELVEHYLAKSGFQCPDVRLIRLVAVATQKFVSEVATEALQQCKARPAPVVRDKKEKQQKDKRLIMNMDDLSKALQEYGVNVKHQEYFADSSSAGMESAQRDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G096310`
TK1151 ID	TkA01G096310
OH-1004 ID	LXL04_033400
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G096310

Location Chr01:24338221-24340463 (+)

Description Similar to TAF10: Transcription initiation factor TFIID subunit 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31720`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	The Arabidopsis mutant stg1 identifies a function for TBP-associated factor 10 in plant osmotic stress adaptation.2006 · DOI: 10.1093/pcp/pcj099 Temporary expression of the TAF10 gene and its requirement for normal development of Arabidopsis thaliana.2007 · DOI: 10.1093/pcp/pcl048

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033400 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0010467 gene expression Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0036285 SAGA complex assembly Biological Process

KEGG gene cross-reference

ath:AT4G31720

dme:Dmel_CG2859

dme:Dmel_CG3069

hsa:6881

mmu:24075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · TkA01G096310 · TK1151

Cytoplasm0.220

Rank 2 · TkA01G096310 · TK1151

Mitochondrion0.020

Rank 3 · TkA01G096310 · TK1151

Cell membrane0.018

Rank 4 · TkA01G096310 · TK1151

Golgi apparatus0.010

Rank 5 · TkA01G096310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15341SLX94-27 aa

PF00808CBFD_NFYB_HMF7-26 aa

PF03540TAF1018-121 aa

PF04577Glyco_transf_6126-118 aa

PF07524Bromo_TP37-81 aa

PF05645RNA_pol_Rpc8251-118 aa

PF00808CBFD_NFYB_HMF56-80 aa

PF15341SLX985-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G096310	`PF15341`	SLX9	4	27	0.0035	18.5
TkA01G096310	`PF00808`	CBFD_NFYB_HMF	7	26	0.056	14.4
TkA01G096310	`PF03540`	TAF10	18	121	3.7e-38	130.5
TkA01G096310	`PF04577`	Glyco_transf_61	26	118	0.092	13.7
TkA01G096310	`PF07524`	Bromo_TP	37	81	0.0098	16.6
TkA01G096310	`PF05645`	RNA_pol_Rpc82	51	118	0.051	14.0
TkA01G096310	`PF00808`	CBFD_NFYB_HMF	56	80	0.056	14.4
TkA01G096310	`PF15341`	SLX9	85	118	0.0035	18.5
TkA01G096310	`PF00808`	CBFD_NFYB_HMF	89	108	0.056	14.4
TkA01G096310	`PF07524`	Bromo_TP	94	116	0.0098	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04173`	Arabidopsis thaliana	sp\|O04173\|TAF10_ARATH Transcription initiation factor TFIID subunit 10	80.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card