TkA01G094780 | RubberDandelionOmics

Gene overview

TkA01G094780

Reference: TK1151 Chr: Chr01 Coordinates: 23945720-23949785 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

892 bp · TkA01G094780|TK1151|cDNA

ATAAAGACAACCATCACCTACCAATGTAAGTTATTTAACAATAAATCCATGTTATACTATCATAACATACGGGCAGCCAGGGTGGAAATAAAAGTCAGCCGTCGCAGCGTCCACACGGACCATAAGACTTCTGTTCTCGACATTACCCAGTTCTTAAATTTGCATCTTCATCAATAAAAATCCTATATTTGAAGAGTCGCAAAGCCAATATTCAATTTCACCTTTTAAGAGAGATTTCCAATTAAACGCCTTGATCAAGT...

CDS

Download CDS FASTA

444 bp · TkA01G094780|TK1151|CDS

ATGTCGAAAATTCCACAAATTAAAAATGAAAACCATAAGAAAAGTGAAACAGTTCCACTTTCTTCTGGTGAAACAAAGAAGAATGGTTTGTCTCCTATCGAGGTTCCTCCATTGATGAAAGGACTTGGAGTCGTTGCTGTTGTTGTTGCTGCTTATGCTTTTGGAGCAATTTCATCCACATCCCGCAAATATATAGGGGGTTTTCGACCTCAAATGACAAGTAGAGAGGCTGCTCTTATTCTTGGAGTAAGGGGAAGTAC...

Protein

Download Protein FASTA

147 aa · TkA01G094780|TK1151|PROTEIN

MSKIPQIKNENHKKSETVPLSSGETKKNGLSPIEVPPLMKGLGVVAVVVAAYAFGAISSTSRKYIGGFRPQMTSREAALILGVRGSTSIDKVTEAHRRLMVANHPDMGGSHYLASKINEAKDKLIKKHKNTDSVFSYKLIVKEEYSQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G094780`
TK1151 ID	TkA01G094780
OH-1004 ID	LXL04_004950
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 77.551 / OH-1004 34.441 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G094780

Location Chr01:23945720-23949785 (+)

Description Similar to TIM14-1: Mitochondrial import inner membrane translocase subunit TIM14-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03030`	Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.	No verified direct reference in this release
`At2g35795`	Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.	No verified direct reference in this release
`At3g09700`	Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004950 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0001405 PAM complex, Tim23 associated import motor Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009536 plastid Cellular Component

GO:0001671 ATPase activator activity Molecular Function

KEGG gene cross-reference

ath:AT2G35795

ath:AT3G09700

ath:AT5G03030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.822

Rank 1 · TkA01G094780 · TK1151

Cytoplasm0.082

Rank 2 · TkA01G094780 · TK1151

Plastid0.054

Rank 3 · TkA01G094780 · TK1151

Nucleus0.052

Rank 4 · TkA01G094780 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA01G094780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30058CIF236-70 aa

PF30912TIM141_C62-135 aa

PF03656Pam1671-126 aa

PF00226DnaJ80-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G094780	`PF30058`	CIF2	36	70	0.12	13.2
TkA01G094780	`PF30912`	TIM141_C	62	135	3.6e-36	123.7
TkA01G094780	`PF03656`	Pam16	71	126	2.4e-05	25.1
TkA01G094780	`PF00226`	DnaJ	80	129	0.0015	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYY2`	Arabidopsis thaliana	sp\|Q9LYY2\|TI143_ARATH Mitochondrial import inner membrane translocase subunit TIM14-3	56.000%	Swiss-Prot	Medium
`Q8RV04`	Arabidopsis thaliana	sp\|Q8RV04\|TI141_ARATH Mitochondrial import inner membrane translocase subunit TIM14-1	52.300%	Swiss-Prot	Medium
`Q9SF33`	Arabidopsis thaliana	sp\|Q9SF33\|TI142_ARATH Mitochondrial import inner membrane translocase subunit TIM14-2	69.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card