TkA01G089990 | RubberDandelionOmics

Gene overview

TkA01G089990

Reference: TK1151 Chr: Chr01 Coordinates: 22866506-22870958 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

471 bp · TkA01G089990|TK1151|cDNA

ATGGTGTACCAGAAGTCTCCGGTGTGGGAATTAGCAGGCCGTCGAAGCGGCGGAAGCAGTCAAGCAGGTCGTCGGAGATATGTTGGTGTCGACTCCTTCTACTTTTGCATCCAATTTCAAGCAGCATTTGTGGGCCACGGGACCTCTGGTATTTTCATAAGGTTTCTAGCTGAAGATGTAAATTTTTTCCATTTTCTTTTCAGCCCTCTGTGCGACGCCGTCGGATCTACTGCCGTCGTTGCGGTAGTGACTCCCGAGAA...

CDS

Download CDS FASTA

471 bp · TkA01G089990|TK1151|CDS

ATGGTGTACCAGAAGTCTCCGGTGTGGGAATTAGCAGGCCGTCGAAGCGGCGGAAGCAGTCAAGCAGGTCGTCGGAGATATGTTGGTGTCGACTCCTTCTACTTTTGCATCCAATTTCAAGCAGCATTTGTGGGCCACGGGACCTCTGGTATTTTCATAAGGTTTCTAGCTGAAGATGTAAATTTTTTCCATTTTCTTTTCAGCCCTCTGTGCGACGCCGTCGGATCTACTGCCGTCGTTGCGGTAGTGACTCCCGAGAA...

Protein

Download Protein FASTA

156 aa · TkA01G089990|TK1151|PROTEIN

MVYQKSPVWELAGRRSGGSSQAGRRRYVGVDSFYFCIQFQAAFVGHGTSGIFIRFLAEDVNFFHFLFSPLCDAVGSTAVVAVVTPEKIVVSDCGYSRVELCRNGVAIPFSVGHKPDRPDELERIEEAGGRVIYWNGARDVGVLAMSRAIGKFLFFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G089990`
TK1151 ID	TkA01G089990
OH-1004 ID	LXL04_032882
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	91.900
Protein coverage (%)	TK1151 55.128 / OH-1004 60.140 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G089990

Location Chr01:22866506-22870958 (-)

Description Similar to PP2CA: Protein phosphatase 2C 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11410`	Major negative regulator of abscisic acid (ABA) responses during seed germination and cold acclimation.	Antisense inhibition of protein phosphatase 2C accelerates cold acclimation in Arabidopsis thaliana.2001 · DOI: 10.1046/j.1365-313x.2001.01048.x Physical and functional interaction of the Arabidopsis K(+) channel AKT2 and phosphatase AtPP2CA.2002 · DOI: 10.1105/tpc.000943 ABA-hypersensitive germination3 encodes a protein phosphatase 2C (AtPP2CA) that strongly regulates abscisic acid signaling during germination among Arabidopsis protein phosphatase 2Cs.2006 · DOI: 10.1104/pp.105.070128 The protein phosphatase AtPP2CA negatively regulates abscisic acid signal transduction in Arabidopsis, and effects of abh1 on AtPP2CA mRNA.2006 · DOI: 10.1104/pp.105.070318 ABA-Hypersensitive Germination1 encodes a protein phosphatase 2C, an essential component of abscisic acid signaling in Arabidopsis seed.2007 · DOI: 10.1111/j.1365-313x.2007.03107.x ABI1 and PP2CA phosphatases are negative regulators of Snf1-related protein kinase1 signaling in Arabidopsis.2013 · DOI: 10.1105/tpc.113.114066
`At1g07430`	Involved in the negative regulation of the K(+) potassium channel AKT1 by its dephosphorylation, antagonistically to CIPK proteins (e.g. CIPK23).	No verified direct reference in this release
`At5g59220`	Acts as a negative regulator of abscisic acid (ABA) signaling for stomatal closure in leaves, and controls water loss during leaf senescence.	An ABA-regulated and Golgi-localized protein phosphatase controls water loss during leaf senescence in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04821.x An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves.2012 · DOI: 10.1104/pp.111.190876 Selective inhibition of clade A phosphatases type 2C by PYR/PYL/RCAR abscisic acid receptors.2012 · DOI: 10.1104/pp.111.188623 Unique drought resistance functions of the highly ABA-induced clade A protein phosphatase 2Cs.2012 · DOI: 10.1104/pp.112.202408
`At2g29380`	Probable protein phosphatase 2C 24.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0457200`	Probable protein phosphatase 2C 49.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032882 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010360 negative regulation of anion channel activity Biological Process

KEGG gene cross-reference

ath:AT1G07430

ath:AT2G29380

ath:AT3G11410

ath:AT5G59220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552

Rank 1 · TkA01G089990 · TK1151

Nucleus0.401

Rank 2 · TkA01G089990 · TK1151

Mitochondrion0.084

Rank 3 · TkA01G089990 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA01G089990 · TK1151

Cell membrane0.061

Rank 5 · TkA01G089990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C54-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G089990	`PF00481`	PP2C	54	153	4.2e-22	79.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49598`	Arabidopsis thaliana	sp\|P49598\|P2C37_ARATH Protein phosphatase 2C 37	81.200%	Swiss-Prot	Medium
`Q9LNW3`	Arabidopsis thaliana	sp\|Q9LNW3\|P2C03_ARATH Protein phosphatase 2C 3	75.300%	Swiss-Prot	Medium
`Q9FIF5`	Arabidopsis thaliana	sp\|Q9FIF5\|P2C78_ARATH Probable protein phosphatase 2C 78	74.400%	Swiss-Prot	Medium
`Q9ZW21`	Arabidopsis thaliana	sp\|Q9ZW21\|P2C24_ARATH Probable protein phosphatase 2C 24	70.600%	Swiss-Prot	Medium
`Q65XG6`	Oryza sativa subsp. japonica	sp\|Q65XG6\|P2C49_ORYSJ Probable protein phosphatase 2C 49	73.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card