TkA01G089390 | RubberDandelionOmics

Gene overview

TkA01G089390

Reference: TK1151 Chr: Chr01 Coordinates: 22712119-22713516 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · TkA01G089390|TK1151|cDNA

ATGGTGGACATTGCAAGAATTCTCGCCCTTCGTGGGGCCACGGTGACTATATTCACGACCCCTCTAGTGGCCAATCGATTTAGACCAGTTATTTCACGAGCATCGGAATCCAATCTGAAAATCAAATTACATGAAATCCATCTCCAATTATCAGAAGTCGGATTACCAGAAGGTTGCGAGAGCTTTGACATACTTCCATCGTTTGAATCTTCCGTCAAGCTATTTGCAGCGATTGAATTGTTAGAAAAACCGGCGGAAGA...

CDS

Download CDS FASTA

1176 bp · TkA01G089390|TK1151|CDS

ATGGTGGACATTGCAAGAATTCTCGCCCTTCGTGGGGCCACGGTGACTATATTCACGACCCCTCTAGTGGCCAATCGATTTAGACCAGTTATTTCACGAGCATCGGAATCCAATCTGAAAATCAAATTACATGAAATCCATCTCCAATTATCAGAAGTCGGATTACCAGAAGGTTGCGAGAGCTTTGACATACTTCCATCGTTTGAATCTTCCGTCAAGCTATTTGCAGCGATTGAATTGTTAGAAAAACCGGCGGAAGA...

Protein

Download Protein FASTA

391 aa · TkA01G089390|TK1151|PROTEIN

MVDIARILALRGATVTIFTTPLVANRFRPVISRASESNLKIKLHEIHLQLSEVGLPEGCESFDILPSFESSVKLFAAIELLEKPAEDLLRGLSPPPSCIISDFCFPWTGGLPDRVEFTKPQIIGSLKTNKPDEMGFWVRAMAAEKSAYGIVVHTFEELEHEYVKELKKAKDTKVWCIGPVSLCNKDNSDIAERGSLTRASTQQMIELGLGLESMNQPFIWCVRDKPEELEKWFSEQGFEERVRDRGLIVHGWAPQVLIMS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G089390`
TK1151 ID	TkA01G089390
OH-1004 ID	LXL04_005094
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.700
Protein coverage (%)	TK1151 100.000 / OH-1004 15.397 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G089390`
Location	Chr01:22712119-22713516 (-)
Description	Similar to SGR6: Protein SHOOT GRAVITROPISM 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005094` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009630 gravitropism Biological Process GO:0009660 amyloplast organization Biological Process GO:0009959 negative gravitropism Biological Process GO:0016134 saponin metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009705 plant-type vacuole membrane Cellular Component GO:0035251 UDP-glucosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:AFN26667 ath:AT2G36810 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.821

Rank 1 · TkA01G089390 · TK1151

Nucleus0.227

Rank 2 · TkA01G089390 · TK1151

Endoplasmic reticulum0.058

Rank 3 · TkA01G089390 · TK1151

Peroxisome0.051

Rank 4 · TkA01G089390 · TK1151

Plastid0.045

Rank 5 · TkA01G089390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N141-180 aa

PF00201UDPGT196-300 aa

PF06722EryCIII-like_C264-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G089390	`PF26168`	Glyco_transf_N	141	180	0.1	13.2
TkA01G089390	`PF00201`	UDPGT	196	300	4.1e-16	59.6
TkA01G089390	`PF06722`	EryCIII-like_C	264	305	0.019	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card