TkA01G088300 | RubberDandelionOmics

Gene overview

TkA01G088300

Reference: TK1151 Chr: Chr01 Coordinates: 22484157-22485597 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · TkA01G088300|TK1151|cDNA

TTGCCATGTGGCGAATGGTTTTGCTCAAGGGAGTGTAGAATACTTCATTCCGTCCTTGAAAAATTGGTGGCTAGTGGGCCCGAGAAGATCTTTGATCATCTTATGGGTTCAGTCAGAAGAATCTCAAAAGGCAGTAGTAATGCCAATGGAATCGGAATCTCCAATTCCGATGTCACGTGGATTGTTGTCCGTGGGAAGGACTTTCCTAATGAGAACCCAGTGTTGCTTACACAGGCTGTCGATATCTTTCATGCATGCAT...

CDS

Download CDS FASTA

603 bp · TkA01G088300|TK1151|CDS

TTGCCATGTGGCGAATGGTTTTGCTCAAGGGAGTGTAGAATACTTCATTCCGTCCTTGAAAAATTGGTGGCTAGTGGGCCCGAGAAGATCTTTGATCATCTTATGGGTTCAGTCAGAAGAATCTCAAAAGGCAGTAGTAATGCCAATGGAATCGGAATCTCCAATTCCGATGTCACGTGGATTGTTGTCCGTGGGAAGGACTTTCCTAATGAGAACCCAGTGTTGCTTACACAGGCTGTCGATATCTTTCATGCATGCAT...

Protein

Download Protein FASTA

201 aa · TkA01G088300|TK1151|PROTEIN

LPCGEWFCSRECRILHSVLEKLVASGPEKIFDHLMGSVRRISKGSSNANGIGISNSDVTWIVVRGKDFPNENPVLLTQAVDIFHACINPIIDSTTGSDFIPSMAYGQIMGDSDFTGVHCAMLTIDSEVVTAGMFRVFGADVAELPIVATSEPYQGQGYFQLFFKCFEKLLGYLKIKKMLVPAAENVKSMWVDKFDFEKVTP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G088300`
TK1151 ID	TkA01G088300
OH-1004 ID	LXL04_005084
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 35.159 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G088300`
Location	Chr01:22484157-22485597 (-)
Description	Similar to IDM1: Increased DNA methylation 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005084` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0015671 oxygen transport Biological Process GO:0035092 sperm DNA condensation Biological Process GO:0042659 regulation of cell fate specification Biological Process GO:0045595 regulation of cell differentiation Biological Process
KEGG gene cross-reference	ath:AT3G14980 hsa:1108 mmu:107932 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · TkA01G088300 · TK1151

Nucleus0.405

Rank 2 · TkA01G088300 · TK1151

Endoplasmic reticulum0.072

Rank 3 · TkA01G088300 · TK1151

Cell membrane0.063

Rank 4 · TkA01G088300 · TK1151

Plastid0.057

Rank 5 · TkA01G088300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18179SUa-2TM64-94 aa

PF23209IDM1_C88-200 aa

PF18179SUa-2TM160-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G088300	`PF18179`	SUa-2TM	64	94	0.27	11.2
TkA01G088300	`PF23209`	IDM1_C	88	200	4.9e-39	134.3
TkA01G088300	`PF18179`	SUa-2TM	160	195	0.27	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card