Gene Card
Gene overview
cDNA / CDS / Protein Sequences
486 bp · TkA01G087260|TK1151|cDNA
ATGCTCTCTTCTCCCCGCTTTGTCTGCATCGTTTTTCCAGCGACCTTTTCAGGCAAGTGTGGTATCCGGCAGTACACAGCTGCTTTGACTATTGTACCCTCGGAACAAACGACAAATCTGTTTAAGGGAATCGTGTCCAACACGAGCCTCAGTTTATACGGATTATTACTTATATATATATATATATATATATATATATATATATATATATATATATATATAGAGTCAAGATCTTTTGAGAACTCATATATTCCCGAGAA...
486 bp · TkA01G087260|TK1151|CDS
ATGCTCTCTTCTCCCCGCTTTGTCTGCATCGTTTTTCCAGCGACCTTTTCAGGCAAGTGTGGTATCCGGCAGTACACAGCTGCTTTGACTATTGTACCCTCGGAACAAACGACAAATCTGTTTAAGGGAATCGTGTCCAACACGAGCCTCAGTTTATACGGATTATTACTTATATATATATATATATATATATATATATATATATATATATATATATATATAGAGTCAAGATCTTTTGAGAACTCATATATTCCCGAGAA...
Protein
Download Protein FASTA161 aa · TkA01G087260|TK1151|PROTEIN
MLSSPRFVCIVFPATFSGKCGIRQYTAALTIVPSEQTTNLFKGIVSNTSLSLYGLLLIYIYIYIYIYIYIYIYIESRSFENSYIPENPRTPKPLTFSKNLLRGAKNRSNISPVAKIFFRKNNFFFSKNFAYVQTFFLCICAQFFVLFQNRSKTRIFLKFVL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G087260 |
|---|---|
| TK1151 ID | TkA01G087260 |
| OH-1004 ID | LXL04_021744 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.100 |
| Protein coverage (%) | TK1151 52.795 / OH-1004 18.201Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G087260 |
|---|---|
| Location | Chr01:22231073-22231558 (+) |
| Description | Similar to CLPX1: CLP protease regulatory subunit CLPX1, mitochondrial |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0051301 cell division Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0009376 HslUV protease complex Cellular Component GO:0009507 chloroplast Cellular Component GO:0005524 ATP binding Molecular Function GO:0008233 peptidase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0046983 protein dimerization activity Molecular Function GO:0051082 unfolded protein binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G33360 ath:AT5G53350 lre:Lreu_0653 nse:NSE_0753 ppe:PEPE_1141 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.